CAZyme Information: MGYG000004493_00937

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D
• CAZyme ID: MGYG000004493_00937
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000004493_4|CGC1	36558.94	5.7616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004493	2547130	MAG	Israel	Asia

• Gene Location: Start: 57804; End: 58760 Strand: -

Full Sequence      

MKKIITFIALTIFSACAFSQNKIKFNETWSYVLTGYENEFSADLPITDLCYFSAEINEYG
EIPSIPNRENIPPEFNGRVHLVAICESRSLSHFVIDPKYKVSKRIIKTLAEATKDFDGLQ
IDFELVPKRDAENFKIFLKKLKKAIGKDKMLSVCVPARTKTIQDDVYDYTELASCADRIF
IMAYDQHWATSTPGPVSGMDWCKKIADHALNTIPVEKIIMGLPFYGRSWAEPNFSKAWYN
SGINRILDENSALEKIQRTEDIPHFEFKTEITVKGWFDDKESLAARCLMLSEKNIPNAGF
WRIGQEDKEFWQILSVQD

Enzyme Prediction     

No EC number prediction in MGYG000004493_00937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	103	308	4.2e-35	0.6824324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	8.77e-41	31	311	8	310	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	7.99e-36	101	318	191	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	3.04e-18	51	311	52	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	6.39e-16	86	305	75	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	3.76e-15	113	305	105	333	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB15386.1	7.44e-230	1	318	1	318
QQA00962.1	1.22e-106	20	318	40	336
QTQ11038.1	1.32e-102	23	318	131	422
QTQ17017.1	1.32e-102	23	318	131	422
QTQ14800.1	2.31e-101	23	318	100	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JH8_A	5.52e-20	116	314	105	310	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
3CZ8_A	2.01e-19	112	303	108	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	2.10e-19	89	315	86	336	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3K_A	6.04e-18	105	315	204	424	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	9.00e-17	119	314	215	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	3.14e-19	112	303	200	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	1.76e-17	101	317	192	422	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	1.97e-16	46	314	132	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
O31682	4.50e-16	88	231	72	214	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
Q9K3E4	2.19e-15	119	314	214	420	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001034	0.278339	0.719840	0.000279	0.000267	0.000230

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004493_00937.