CAZyme Information: MGYG000004495_00055

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004495_00055
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	MGYG000004495_1|CGC1	50933.97	5.3505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004495	2923471	MAG	Israel	Asia

• Gene Location: Start: 63642; End: 64991 Strand: -

Full Sequence      

MKYYFVVGEASGDLHASRLMAALGEVDPDAQFRYFGGDDMKAVGGTCVKHYKDLAYMGFV
PVLLHLGTILKNMSFCKKDIARWKPDVVILVDYPGFNLNIAKFVHDKTGIPVYYYISPKI
WAWKEWRIRNIKRDVRELFSILPFEVPFYEIKHHYKIHYVGNPTVQEVAEFRDSYDQSYQ
SFCKEHQLDAYKPIIALLAGSRKQEIKDNLPAMIEAASRFEDYQMVLAGAPSISDSFYQK
WIGGTDVKLVKNRTYPLLVHAKVALVTSGTATLETALFDVPQVVCYETPIPRLIRFGFKH
IIKVKYISLVNLIADKKVVPEMLADLFTVDGIASELRKILPGQPGRDKMLAGYQEVRRRL
GNNVAPEQTATLMYDLLQTYTSDSGLPIHSVDSAREQESEDQYEPSAPADENSGYSDEPE
SQDFDTIDPDGQDDRPTSPENDSPSRPEE

Enzyme Prediction     

No EC number prediction in MGYG000004495_00055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	8.4e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.56e-98	1	379	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.61e-93	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.43e-66	4	323	2	322	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.01e-59	6	376	11	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.36e-46	52	365	46	341	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66516.1	2.01e-204	1	377	1	377
QUB87398.1	3.41e-198	1	377	1	376
AKU68449.1	3.41e-198	1	377	1	376
QUB55731.1	7.39e-198	1	404	1	399
QUB58331.1	7.39e-198	1	404	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.42e-29	6	378	12	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.43e-29	6	378	12	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	7.81e-65	6	377	12	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	4.17e-64	6	377	10	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	2.53e-62	6	377	12	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	3.72e-61	6	378	9	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q02AZ6	1.92e-60	8	378	9	374	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004495_00055.