CAZyme Information: MGYG000004495_00062

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004495_00062
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000004495_1|CGC1	37314.61	7.326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004495	2923471	MAG	Israel	Asia

• Gene Location: Start: 72436; End: 73413 Strand: +

Full Sequence      

MKKTILILCLFLIALPFEAKNKYDNPDTLFVARDGTGEFRTIDDAIEVCRAFMEYHKVIY
VKKGIYKEKLILPSWLENIEICGEDRDKTIITWDDHANIKLPGTDRPMGTFRTYTLKIEG
NHITLKNLTIENNAARLGQAVCLHTEGDCLKFVHCRFLGNQDTVYTGTAGTRLFFKDCYI
EGTTDFIFGPSIAWFEGCTLYCKSNSYITAASTPRSQTYGYIFNHCKLVAAPEVTKVYLG
RPWRPYAYTLFIHCDFGPQIRPEGWWNWGNTANEETARYFEFGNTGTGADITHRVPWSHQ
LTQKEARQITPQKIFTLCSTWNPTE

Enzyme Prediction     

No EC number prediction in MGYG000004495_00062.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	315	1.7e-95	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	5.29e-72	29	308	7	289	pectinesterase
pfam01095	Pectinesterase	2.16e-68	31	313	4	293	Pectinesterase.
PLN02682	PLN02682	1.05e-65	19	307	61	353	pectinesterase family protein
PLN02432	PLN02432	2.36e-58	31	306	15	277	putative pectinesterase
PLN02708	PLN02708	2.56e-53	31	304	245	532	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	9.12e-173	1	324	1	324
QVJ81978.1	1.57e-170	1	323	1	322
ADE82952.1	1.57e-170	1	323	1	322
AGB28242.1	1.33e-169	1	325	1	325
QJR97878.1	6.10e-160	23	323	16	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.92e-39	31	297	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	2.76e-38	31	297	11	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	2.11e-34	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.12e-33	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.78e-25	39	324	18	340	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	9.87e-56	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.81e-48	28	323	272	569	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q8VYZ3	4.74e-48	19	307	75	367	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q5MFV6	1.91e-47	28	297	276	552	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	7.79e-47	28	323	259	556	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000424	0.998704	0.000364	0.000169	0.000163	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004495_00062.