CAZyme Information: MGYG000004495_00942

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004495_00942
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000004495_12|CGC1	40547.1	9.4102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004495	2923471	MAG	Israel	Asia

• Gene Location: Start: 22452; End: 23489 Strand: -

Full Sequence      

MKILVVRFRQMGDAVLATCVFNTIKRNDPEADTTFILNERLAPLFKGHPAIDHIITFSES
DNENLWCYLRKVWRIVHHNHYDVIIDMRSTLKSMFFTLFSLSTEYRIGLKKWYTGFAFNY
FFEKTNRNKCMIDHDLMLLSPLNYKVWDQNFHIPITENEKEEFKDYMVKMKIDFSKPVVL
MGVTSKLKNKTWSEEGMVYVVRNLIKTFPQVQIIFNYALGKEEQASRRIYELLDNDPHIF
IDIRAQSPRQLAAMASWITLYFGNEGGARHIIHSQDKPSFVVVAPQNSKKMWLPQNGIPT
GGVGIEDFVSPSQLAKIPTDRQYDLIKKEKVWIEFLKFINKYHIL

Enzyme Prediction     

No EC number prediction in MGYG000004495_00942.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	71	294	7.4e-23	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.95e-36	1	341	2	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	5.80e-29	2	297	1	236	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	8.68e-05	2	87	7	94	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	2.12e-04	70	287	2	213	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28725.1	1.46e-104	1	337	1	336
ALJ48104.1	2.48e-101	2	341	6	350
QUT78842.1	2.48e-101	2	341	6	350
QDM10840.1	2.48e-101	2	341	6	350
SCV07513.1	2.48e-101	2	341	6	350

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004495_00942.