CAZyme Information: MGYG000004495_01553

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004495_01553
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000004495_24|CGC1	46055.63	9.0895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004495	2923471	MAG	Israel	Asia

• Gene Location: Start: 34673; End: 35872 Strand: -

Full Sequence      

MMKKIRYIAFLFLLVPLITMKAESVEQVKAMITKVNDYWQTHHQPQDRAVWNIAVYHTGN
MAAYQLIDNPQWLRYSELWAEHNHWQGATEKDSSKWLYKTYGEDPQHVLFGDWQVCFQTY
IDLYHLSPDPVRIARAKEVMSYEADSKANDYWWWSDALYMVMPVLTKMYKLTGEVKYLDK
LYDNILYSDSIMLDHDTGLYYRDARYVYPAHQTASGKKDFWSRGDGWVLAGLAKVLQDMP
KTYPHYSFFLKKYVRMAYAVAKLQQKEGYWIRSLLDPAQAPGPETSGTAFFTYGILWGVN
NGILSDKDFKTVIKRSWKYLSKTALQKDGSVGYMQPIGDRAIAGQSLDQHSQADFGVGAF
LLASCEYVRYLANNKYYDKKKSVFTGGGVFVGVGAGFGR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	369	7.5e-75	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.99e-80	28	371	6	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.90e-39	44	369	29	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84432.1	2.01e-187	26	371	8	363
ADE82673.1	1.23e-181	2	371	1	369
QVJ79822.1	4.97e-181	2	372	1	370
AGB28481.1	5.50e-173	26	371	25	378
AND21736.1	1.51e-172	11	379	15	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.41e-155	19	371	24	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.22e-138	23	371	11	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.25e-47	26	369	27	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	5.26e-16	151	366	138	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.16e-15	151	366	128	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	8.07e-47	26	369	34	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	4.50e-45	152	369	157	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.03e-40	142	366	189	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.88e-15	151	366	138	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998881	0.000239	0.000176	0.000167	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004495_01553.