CAZyme Information: MGYG000004495_01779

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004495_01779
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	MGYG000004495_30|CGC1	61037.15	9.9427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004495	2923471	MAG	Israel	Asia

• Gene Location: Start: 11481; End: 13070 Strand: +

Full Sequence      

MKSRNTVLFALLIILSVTTFFINRGALPTDIMESRNIVTAREMVSDGNWLVPTMNGELRL
EKPPLPTWVAGAVEMIAPGSLSAQRFAPAVMGLIWTLFLFLTARYLTRRDDFAVNTVLVF
ITLYNVVLMGRSATWDIYCHAFMMGAIYFLMRGFYDDDHGFYEEDRGFYDSGLVHQHKWR
WFLLAGLFMGLSFESKGPVSLYALLLPFILVVICLRRPHMKGKWGPLIVAILITLVLGGW
WYAYLLTYHSEAVEYVIHKESSAWSGHNVRPWYYYWRFFLEGGLWAPFILLSLAVPFWQK
RLEQPRKYFFVVLWMLLQLVLLSCMPEKKMRYLLPMAPTIAMSVAFVLMWLETESRHKNL
TKGFVWTYAALFFIAELFFLQPVGKMFGNPEAHSINAVSQISTLKHVPFYHNAKEPLRIE
LVYEANRKILPMNLSDSIEVMSSLPLAVVSQKPIAQEMPVSILKHLDVVKIGYYDDNKHP
KKDRHYSSAFLNYVTLLKKKMDTTPKKAINPPVTGKKGRSILHSAYPRK

Enzyme Prediction     

No EC number prediction in MGYG000004495_01779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	380	4.7e-63	0.6555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.87e-23	1	378	4	364	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.55e-10	62	242	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.10e-06	32	249	31	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
PRK13279	arnT	1.70e-06	1	235	2	221	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1928	PMT1	0.003	47	196	76	209	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGP84549.1	4.97e-21	24	392	29	380
AGP92548.1	4.97e-21	24	392	29	380
AGP80717.1	4.97e-21	24	392	29	380
AGP88666.1	4.97e-21	24	392	29	380
AMJ84646.1	6.56e-21	24	392	26	377

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.91e-13	33	387	30	359	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	2.70e-12	17	365	12	348	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
Q7N3Q9	2.58e-11	33	385	36	374	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
C5BDQ8	7.41e-10	33	398	32	384	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q6D2F3	1.72e-09	33	345	35	332	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.920197	0.077907	0.001214	0.000131	0.000111	0.000467

TMHMM  Annotations     

start	end
7	26
84	106
113	135
198	215
224	246
273	295
308	322
332	351
363	380