CAZyme Information: MGYG000004495_01991

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004495_01991
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		41252.36	8.9049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004495	2923471	MAG	Israel	Asia

• Gene Location: Start: 5462; End: 6535 Strand: +

Full Sequence      

MKKSKILLFLVTFLIVSATTMNVCANPGQRWTVDKVNKWYSAQPWLAGCCYIPSDAINQI
EMWSADTYDAAQIDKELTWAQNIGFNTLRVFLSSVVWQHDPTGLKNRMNNFLDICKKHKI
RPFFVFFDDCWNPVSYYGRQPSPKPGIHNSGWVQDPMKSMRADTTQLYPLMKAYVQDILK
TFKNDDRVLMWDLYNEPGNSKFGDTSLPRLKKVFEYAREVNPSQPLTAGIWMQSPQINQF
LATHSDVISFHCYAKPVELQHAIDTLRQYNRPLVCTEYMARPNGSTFQDNMPVLKRNHVG
AINWGFVSGKTNTIFAWDKPLPNVKEPKVWFHDIFRPDGSPFDPKEIEVIKSLTAHQ

Enzyme Prediction     

No EC number prediction in MGYG000004495_01991.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	56	313	8.9e-111	0.9963636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.76e-05	63	304	19	266	Cellulase (glycosyl hydrolase family 5).
cd09858	PIN_MKT1	2.89e-05	101	195	55	134	FEN-like PIN domains of Mkt1, a global regulator of mRNAs encoding mitochondrial proteins and eukaryotic homologs. The Mkt1 gene product interacts with the Poly(A)-binding protein associated factor, Pbp1, and is present at the 3' end of RNA transcripts during translation. The Mkt1-Pbp1 complex is involved in the post-transcriptional regulation of HO endonuclease expression. Mkt1 and eukaryotic homologs are atypical members of the structure-specific, 5' nuclease family (FEN-like). Canonical members of the FEN-like family possess a PIN domain with a two-helical structure insert (also known as the helical arch, helical clamp or I domain) of variable length (approximately 16 to 800 residues), and at the C-terminus of the PIN domain a H3TH (helix-3-turn-helix) domain, an atypical helix-hairpin-helix-2-like region. Both the H3TH domain (not included in this model) and the helical arch/clamp region are involved in DNA binding. Although Mkt1 appears to possess both a PIN and H3TH domain, the Mkt1 PIN domain lacks several of the active site residues necessary to bind essential divalent metal ion cofactors (Mg2+/Mn2+) required for nuclease activity in this family. Also, Mkt1 lacks the glycine-rich loop in the H3TH domain which is proposed to facilitate duplex DNA binding.
PRK10150	PRK10150	0.006	175	280	396	511	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK66901.1	5.11e-159	6	354	10	362
QJT73071.1	1.51e-158	3	353	4	353
QUR46124.1	4.17e-158	6	354	10	362
QRN00157.1	4.17e-158	6	354	10	362
QNL39416.1	2.40e-157	8	354	12	362

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002623	0.665650	0.330903	0.000349	0.000233	0.000230

TMHMM  Annotations     

start	end
7	29