CAZyme Information: MGYG000004495_02404

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004495_02404
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000004495_58|CGC1	78012.15	7.3076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004495	2923471	MAG	Israel	Asia

• Gene Location: Start: 6499; End: 8538 Strand: -

Full Sequence      

MNLLFRSNMKIKILNILLLLLINNSFVCFAQMVDHPDLTRRNTNYVDSRIPLQPVSFIKL
PVGSIHPLGWIGKYLCLQRDGLTGHLNEISAWLSKDNNAWLSLKGDHGWEEVPYWLRGYG
DLAYILQDKKMLDETQFWINAVLKSQKPDGSFGPVNLLNGKPELWAHMIMLDVLKSYYEY
SGNKRVIPFMTKFFKWEFSLPEDQFLKSYWENSRGGDNLKDVLWLYNRTGEKFLLELAKK
IHRNTADWCQESTLPNWHNVNIAQGFREPATYFNLTGDSSYLKAAYHDHFLVRRIFGQVP
GGMFGSDENSRMGYVDPRQGVELCGMVEQMASDEYMLRLTGDPYWAANCEDVAFNTYPAA
VMPDFKALRYITSPNMIVSDSKNHHPSIDNSGPFLSMNPFSSRCCQHNHTQGWLYYSENL
VYATPDNGAAIVLYGACTADMHVAEGKRITVIEETQYPFDENIRITLRMRGKTAFPFYLR
IPKWSEDPIVSVNGKSLSVSSDRNYLRINREWKSGDVIILHFPMTVKMQTWQSNENSVSV
NYGPITFSLKIKEKYVKYNSKENVISDSQWQTGVDSSLWPAYDIYANSPWNYALDLDSNQ
QLVDMKIIRKPLQKDKLPFTEENVPIEILTKGCRIPSWKTTSDGLCGVLPEENALRSQPE
PITLIPMGAARLRISAFPR

Enzyme Prediction     

No EC number prediction in MGYG000004495_02404.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	321	547	1.4e-32	0.42366412213740456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.94e-112	40	548	14	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.23e-24	108	527	57	479	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL79118.1	3.88e-173	45	678	39	662
ADO72059.1	6.62e-171	45	679	35	651
QPI54544.1	5.08e-168	49	678	38	649
AUA15891.1	7.17e-168	49	678	38	649
AQA10145.1	1.01e-167	49	678	38	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	1.76e-19	322	550	381	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6EX6_A	1.71e-16	123	547	80	544	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.93e-14	111	550	78	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	8.53e-12	400	550	408	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.999002	0.000185	0.000174	0.000148	0.000137

TMHMM  Annotations     

start	end
13	35