CAZyme Information: MGYG000004499_00623

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_00623
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824		92746.88	9.127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 34813; End: 37287 Strand: -

Full Sequence      

MRALSVCLLQLAVASLLSAAKIEVETGRGSPIHVLIPGEENRLGLRIVNDGKREEQFTLK
YVVDNYDGSRLHDGGETCFFLKPGAKRVISLPKPEQFGVRFIKATLAGNVSGTISKRLSY
CYMKPSGPTAGRAKGFLFGICVHSQRFPLADQEREAMAAAWCGAKVFREDISWWTAELEQ
GKWNWSRFDHLVALYGKQGIELQALCAWLPRWVLKEFDRTGCPEEWGEFIRRFATRYRGR
VRYMEVWNEPDLNTFKGNPEKYLKLLRIAYREVKKHAPEMLVMTGGVSGMVSTKQQTAFV
RQMLRDGKNYYDIIAFHGHGNLPSYLTHINPFLAARKEFGITAPWYANETAEPTTWSSEA
GQAVTLFKKLLVSWARGSIGYNWYDLRNDGVDPNNAEHNYGMLTQDFYPKPVYATYNMLA
GTFREAEFLEDADPGRPFQAYWFRSRGNGYLLPAWSDESGETLLAIAGDGKFSRIDLFGN
QTPQTALDGITAYAVGGLPAALYNSETETKPEIRGKFLSTDGVFNLFPGELRNLELDLSN
PAKSELLFQIKLHLPKGLSGSRTTVEQRVSPAGQCRLVLPLRAERNFCSLPDRPQKIGVE
LRLSAGKRVLWSGLMQKEVRTVTDLPRNKFSVQPNFILNHPGQVARLIPSAPENEPRYWK
GPDDLSATVRLAVKQNALLLRIEATDDVHCQPHKAAESWCGDNVQCALSIPGQSSRWEIG
LTRLADGKPEVWVWMAPNGFSREKTAAKIKLTTARDETRKTTVYQAEIPFESIGLSERIG
RRGFLFNLLINDNDGEGRDNAIWIAPGNTEEKALGRFPTILRFR

Enzyme Prediction     

No EC number prediction in MGYG000004499_00623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	177	430	4.6e-30	0.6821345707656613

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	3.57e-62	634	821	1	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	3.45e-11	659	808	30	176	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	4.40e-10	659	802	12	156	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
PRK13026	PRK13026	0.002	148	232	40	119	acyl-CoA dehydrogenase; Reviewed
pfam00331	Glyco_hydro_10	0.004	129	250	3	128	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF90198.1	7.61e-284	21	820	192	1003
AHF94342.1	3.41e-209	29	821	222	1031
AVM46276.1	1.98e-172	30	821	336	1135
AVM47149.1	2.26e-163	29	821	499	1305
AVM44759.1	5.16e-132	19	821	157	963

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.41e-18	139	506	107	500	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999160	0.000163	0.000145	0.000139	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_00623.