CAZyme Information: MGYG000004499_00742

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_00742
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		39929.16	5.6883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 14490; End: 15545 Strand: +

Full Sequence      

MELVDRIEFAYPVSTMFEADSTWLFGREPTPRRMPDGSIVSLLYTGGKQEPAPENVATVI
RSEDDGETWSKPQLLFRHPFRCTWGTELFTEGERPFAVFQTFCYETVYAELRAFLTFTDD
SGRSWSNPVSLPGVPANFSVRQGKVLSDGSWIFPVYWFCNRTKWDTIRAPGNGFVSGVIR
STDGGKSFSLHGAVETPESAWEPEVTELEPGHLKMYVRYEHPAAVLWESESFDYGKSWTP
ARPTEIPNPGTKFVIYRIRGRHVLVNNVCTPDHPYRDVLELWVSSDNCATWEKKLPLARS
FPGPLQPNGKPAITQVAYPHGFADEKAEKLYLAIDTVRKFYFLKVPFADFL

Enzyme Prediction     

No EC number prediction in MGYG000004499_00742.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	110	294	1.6e-24	0.5321637426900585

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	5.86e-33	52	297	41	299	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.18e-19	46	315	9	272	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	1.12e-06	12	237	128	332	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	3.25e-06	29	273	36	272	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
smart00602	VPS10	0.001	231	340	15	112	VPS10 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44953.1	1.29e-200	1	351	12	367
QDT47605.1	2.67e-38	13	349	39	367
QDU43183.1	7.27e-38	13	349	39	367
QDT64740.1	3.18e-35	16	339	38	366
VIP09454.1	3.95e-34	28	346	433	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	1.06e-06	59	239	216	413	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_00742.