CAZyme Information: MGYG000004499_00962

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_00962
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564	MGYG000004499_7|CGC2	62747.21	9.7259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 46509; End: 48203 Strand: +

Full Sequence      

MRYFWFVFLFFIVAYLVPLAGRPLVTPDEFRYAEIPREMIADGDYVTPRLLNVRYFEKPV
LGYWLTVGCFKMFGDNAFSIRLPAALGAGLTALLIWLLVDQALRDRKLAALAAIFYLSCG
LVYGIGTFAVLDSQTTAFITGILVTSYLAAVEPCFNRRKALLLVLCGVFTALAFLTKGFI
AFAVPGLAMLGFLIWERRWKEFLILPWIPLVVALALIAPWAIAVHRAEPDYWRYFVVIEH
WQRFTADAPGQHPEPFWFLFPFLVGGVFPAALLLIPSFSVGRTAAGKLLQQPLYRFCLSA
VVLPFLFFSASSGKLATYILPCFPPLAVLAAALIAAYFKSGGHNRGFHRMVTIWGGLLVI
AAVGFGIVLFLPFMKRVAYGWCFPAAVAMAVVGLAYGASLLLSRRADWRMRFHLFFAGMA
LLLAVGGWAIPDGLLGDKAPERAMRELADRLGFDPKSAKFFTTPSTMHAVAWVFGREDVQ
TLNSRGELDYGDTHAKAEGKPGVMIDRAELDRMLTSPSHPAVVVIGRDRRSFYHPPVGTK
YREELLNEIRAIYIPEKGKQGGVQ

Enzyme Prediction     

No EC number prediction in MGYG000004499_00962.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	2	501	3.1e-110	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	1.33e-118	2	500	6	496	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	1.67e-51	1	448	7	444	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	2.78e-17	4	235	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.17e-14	58	222	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG5305	COG5305	1.90e-05	57	308	96	362	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46372.1	1.54e-230	1	558	1	555
QSH42095.1	8.97e-118	11	527	12	525
QSH42096.1	1.96e-107	11	531	13	529
AVM46371.1	1.97e-92	11	560	13	563
ARW83417.1	7.87e-90	5	498	6	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	5.62e-33	12	334	42	364	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	6.14e-90	5	498	6	489	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	5.10e-88	5	500	6	491	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
Q6D2F3	8.56e-84	11	497	17	494	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
C6DAW3	4.96e-82	11	497	17	494	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
B2VBI7	2.50e-81	9	500	12	495	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.293480	0.700029	0.002970	0.001126	0.000917	0.001461

TMHMM  Annotations     

start	end
3	25
77	99
108	130
134	151
160	174
178	195
202	224
257	279
292	311
316	338
351	373
377	399
412	434