CAZyme Information: MGYG000004499_01141

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_01141
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1007		110948.94	7.0542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 64598; End: 67621 Strand: -

Full Sequence      

MKRLSQLCGIFLTVAASLAAFAGAAPVSKTDGARSLLLSNFRDNPIGKAPEFWSTWCRKG
MLFSAEVTESDGRRVAHLFSNGKQDWAFTRSRIVPVSPGLRVRLSCRAKSNDGHRGSVFL
QLTGLRNRKLVSFALINQPLDHLSGEWERYSATLVLPSNVDSVGIRFQGRGTCDLLVDDI
LLEALPPEKRIPRPVRGFATERITEKLDRGLVAFQTPEGDYLSWRLLASDDPQIGFDLLR
HSEDGTTKLNPSPLVQTTDFLVENPVPGSIYELRPAAGFSGVSGKAEARPNPGPRSPCAV
YRLSDPLAQVNKIGIGDLDGDGTYDFVARYGAPGIDMWKSNVDPWYTLWKPSTHPFVLEA
LRSDGKLLWRKNLGWNLESGIWYSPFLVYDVNGDGRAEVILKAFAPEAGDLREKSGENRG
KVVRGEEFLMVWDGLTGREIARAPWPSREPFLNQKMAYNFYSRNQLAVAYLDGKTPCIIA
LRGTYNIMLAEAWQLKDNTLKQLWQYDSRRYGREYRGQGAHTTRTVDLDGDGRDEIVLGG
AVLDDDGQPLWSSGHGHPDHIFVTDVTNTNPGLEILALYESPCLTGGFSCADARTGRILW
ELSESSRHIHFGYAGDIDPRYRGWEVGGADILGGKPGGPKPIVRHFSPEGKLLYSGDAAP
YRKSRHFLYWDADLQREDATPVVCDFNGGPSGGGFVGKFLMQADILGDWREEALTVLNGE
FRVYSTTIPAMDRRICLMQDPAYRQTIAANSMGYLLDPALSYLPTNRSPNLNLTFRQTGE
NSRLEIVVSAPLQTPLKGTLVISGEGDCLPSPLRREIDLKAGESMLRQEFLPENTSPGKR
IHAKLTLLDGRVLRGGCLTGVAPFQPDEGCILLEAEAFSEATGPRVKIRSDKPGAHGKSI
SHWDKKEQTLFWQFAVPVAGQYRLEARFATNDDARRTLIVDGVESGWLNFPATGGLGAGP
AEWLTFPPLRNGAAVTLSLTAGTHCLGLRNIDGAPLNLDCLLLKPVP

Enzyme Prediction     

No EC number prediction in MGYG000004499_01141.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	202	763	3.3e-117	0.9323432343234324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	7.02e-116	205	762	2	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	4.63e-18	205	292	4	82	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
cd04083	CBM35_Lmo2446-like	1.32e-07	916	1003	45	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04079	CBM6_agarase-like	1.93e-07	916	984	51	111	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.
cd04082	CBM35_pectate_lyase-like	2.92e-07	912	992	40	120	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44648.1	7.18e-214	191	1006	498	1287
QNN21898.1	6.86e-144	202	761	30	580
ASV76202.1	2.83e-138	201	762	37	582
QQY43071.1	1.99e-126	183	762	36	612
QJR69510.1	2.05e-126	183	762	37	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	5.28e-85	202	762	3	566	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
4CAG_A	1.44e-81	199	771	6	587	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	6.11e-79	201	762	5	587	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	1.66e-85	194	762	32	603	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	2.78e-78	201	762	5	587	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000421	0.998854	0.000192	0.000188	0.000171	0.000156

TMHMM  Annotations     

start	end
7	28