CAZyme Information: MGYG000004499_01260

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_01260
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789	MGYG000004499_11|CGC1	88777.61	5.8967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 48762; End: 51131 Strand: -

Full Sequence      

MREKILLNDDWRLLVNPPETAIPVSKAAMYLSAKTERLKWGPGAYRHNDVPGFWDLEQEL
PAEPWEKVDLPHDYIIRQAPDPNEAGALGFFHYVPAWYRRHFTLAPEDANRRLTLYFEGI
NGISELYLNGCFLKRSTSSYVPFEVDITDLARFDRENVIAVYTDPRSFEGWWYAGGGIHR
NVWLVKTAPLAVDLWGVFVPVRKETETSWRVPVEVTLRNIGYEAEEASLRCEILAPGGGK
AGEILLSGTVPARDTATLRGETRVDSPLLWDLDAPHLYTLKVTVRRKDGETCDMVEQRFG
FREIEMTPDRGLFLNGRHVKIKGVCAHQDFGLTGKAVPDNLCRYRVSLFREMGANAFRAS
HYPHPEATMEACDEQGLLVLNETRRYESNEEAVAQLEALVRRDRNHPSVFLWSTGNEEMA
YHGMEQGHRIHRALEHVIRRLDPTRPVTTAITNVPDASVYAISEVIGVNYNLDQLDDLHR
RFPEKPFVSSENCAVGSTRGWYWGDSPERGYMDARDFNPGPGTFQLFGRERTWKFFMERP
WISGGFQWDAIEHRGEAIWPRLCSCSGALDLFLLKKEAFYQNQSHWLERPMIHLLPHWSH
PGFEGMPVSVWAYTNCDEAELFLNGVSLGRKRVEKYLHVEWQVLYTPGKLEAVGYLDGLR
AAGDVRETAGPGVKLALKLENGPVAAGGNEIALFTCSVLDAEGREVPDASPLVRFDCSGA
GTILGTGSDNTDPVPVPSLDRRMYAGKIAVALRPGKADATGTAKATLIARSESLCSAYLP
VEFLAPAEK

Enzyme Prediction     

No EC number prediction in MGYG000004499_01260.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	559	1.1e-101	0.5851063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.43e-60	1	558	9	507	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.76e-43	49	469	14	470	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.44e-43	93	447	103	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	5.42e-32	93	447	114	485	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	1.06e-30	311	553	6	245	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY34329.1	2.19e-260	1	755	1	752
ASG21865.1	1.01e-164	65	746	48	744
CCW35398.1	3.75e-162	65	774	204	933
ANE47110.1	2.50e-161	2	742	17	744
CCW36355.1	8.81e-161	65	782	215	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GM8_A	2.06e-110	65	762	34	781	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5T98_A	2.47e-99	65	771	54	816	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	7.91e-93	51	778	32	806	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6B6L_A	1.46e-92	57	756	26	754	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	5.82e-92	57	756	26	754	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	5.19e-108	51	764	64	837	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	7.43e-79	49	753	61	794	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	6.41e-60	65	753	55	769	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KPJ7	3.06e-51	55	756	69	803	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	6.39e-51	96	725	58	695	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_01260.