CAZyme Information: MGYG000004499_01696

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_01696
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920	MGYG000004499_19|CGC1	103423.2	9.1301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 50716; End: 53478 Strand: -

Full Sequence      

MFCRQLTWILASAAMLAAIGAEPLKIRGTAFANWWRTGETVCFKGNQPIPENDRIRVKVN
DVTGATLYTGEVGGREFNEKGWCWQPPSPGYYEAEFFRSGSVNGDVAEQYRFRVYKQDRH
TKKYSLAGDTQIPVTKHPFGVATPTRPVAEISPVFGMSPHFGRYRDFLPLSRLVGFRGIR
VHYIDWAKLEKEKGVWNWKALDEFMKLAREYGYSEEDITLNLMGTPRWASTRPDATWINI
CIQEYKTVIPKQMEDWRNFIRAVMRRYPGVKKYELWNEPHLIGYSCFWSDSVENFVALLK
AGYETVKAENPEAVVHLGGIGMRYLPFYRELLKLGGDRYYDVLPMHGSWVQMAPFRRMEK
QFGRKSKPWLSSEWHAMLLRASFPWPSEPMQTRNMLCDFLNQVRQGAQEVDFFCIVNAPN
FEKECLPWMKKFDPGSASHVSGLFRKTPFLAPRYQALAWHVLSDLVRGKLTVHDGFRFGD
GKDQCGILLSSDAGELLIFWTEGEKPVRIDRELANIVAASVVCEADGRPVSRPAEMTLAP
EFYYIARNPDRKLLAAAKGRGAEVLIPQGKALPLSHEMHGNYLPGKLFDAKLELTAAGRR
APRMALAEKVVCDSSARAGEIAGFFSVALDRENFELYAELEDAVHHPVPGEAPWKGDSIQ
FAFDGGGKGLAGDRIEFVLTLDREGRAGVVKNFAAPLGGDLPERYTPANEPMRTAAVAGE
RRNGRTVYRLRLPVSELYPLTVPPNGTLRFSLLANNNDGNGRAYYREWASGIGGEKSPAE
YGDLTVLQPVRELLKGRPFRPFRQGADQRLAATANGYRVDAGAIGRKDAAGVAVSVGNLL
PNASYRLTFRARGTARLEVVSFAGAQRIDLVKRTSLKPEWQTFEAVLTLPEGRNAASLNF
FAWEQPGVFFEVSDISLTPY

Enzyme Prediction     

No EC number prediction in MGYG000004499_01696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	172	392	2.8e-23	0.4709976798143852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	3.10e-33	625	785	32	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	3.04e-07	613	768	10	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam01229	Glyco_hydro_39	7.26e-06	250	332	121	208	Glycosyl hydrolases family 39.
smart00633	Glyco_10	4.17e-04	186	279	3	86	Glycosyl hydrolase family 10.
pfam02449	Glyco_hydro_42	5.39e-04	172	310	20	169	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45582.1	5.56e-269	9	920	8	918
AVM45605.1	3.55e-125	25	785	346	1092
BBH20281.1	1.08e-112	26	798	216	988
BBH24554.1	1.32e-102	22	786	373	1137
AHF94113.1	2.64e-92	17	790	209	985

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.999115	0.000159	0.000142	0.000129	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_01696.