CAZyme Information: MGYG000004499_03162

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_03162
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1051		119880.18	8.1579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 1607; End: 4762 Strand: -

Full Sequence      

MMKNFFSIFSVSLLVFRLVAANLCDDTSQWLLEGKSSDYSRLENVTAHGRNALRLLYDFK
IQQGRDLALILKLKEPLELKEGARLSLSIYDTSSAHRFYFMCRDAGGKSALFSYTENDFR
TLRHTGWKEYGFSPSVDRCDLWGGDSGTNRRLEYPVRLIAFWLDPVNRTRMQGEIFLSNL
CIDGKEVKTQSSPSLRRKTAAAEELHPQLSLSGAGDGTLSWSGEKQVFHFRFQPGSRRFG
ICCEEIAFLDPYGNLLARRERRIDADRAYEHVVPLPEEVSGFFRLRFRLRQENAILFEEQ
ATGGHFTPVPQPPPEEARLGVGFWHNNPERAYAVLRRMGIRWVRTDVGWSWIEPKRGEFH
WESIDRSLRAAEANGMALLVTTQYVPRWAAQQPYHQYGGNPDPAEWERFFRQLFERHGRR
IAVCEVWNEPDTPYHWSGGAAAYAVHLKRAADVIRRHAPQTKIAHAGLTGEEKLWRPFSE
ELVQYRIGDAFDVYTFHYGQGKSVPLHRRILEQAGLGNKPLWNTESGWGSPAERIFHIVR
DFAAGAEKSFYFEFQTKVPQFAQTGMMTNEFQPNPVMPLFLTFSRLLDGRVPVEQLPFSP
GEMYRIAREQVIFRTPVGVTFRTGAKSLIYTDGFGRERVFTPFAGCVGVPAGEVAYLTLP
ENFELLPSMLEFSGDAMPVAGTSTRFVLTVRNPAARELRATVRLCGPRQWECSTAQQEIV
LSPGKRCRVELELRPDLLSSETPFRCDAVLESAGNTMAQQSFSGKVCSPVESSIRSCFSA
GKPGIHITLRNLLDQPLETGVALRLPASWNCDTWRSVTLAPKSSKEFSVLLENVTTLRKE
RTYLIDVILSALGASSRTEYRLNWIGIPLVENFCSWEKLPQEAELARRVNYVPDHEILET
WLGPEDLSCRFRWGWSPEWIRMRWEVTDDRHVNDNTPAFAWGGDSVQVWFDGRLYDLAQL
RKGSSLYCHDTAADTSRIRLKIARSGTRTIYDLEFLPASGEKFRDGMNFPFSFCVNDNDG
EPTRKGWMYCFARTGISGERKNSPRVTLMAK

Enzyme Prediction     

No EC number prediction in MGYG000004499_03162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	356	504	1.2e-20	0.37587006960556846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.52e-25	901	1045	22	182	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	4.12e-09	875	1024	11	166	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	5.38e-09	900	1025	11	154	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam02449	Glyco_hydro_42	1.19e-04	329	392	13	79	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG3867	GanB	2.25e-04	318	498	53	252	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47094.1	0.0	6	1051	25	1072
AVM44950.1	1.06e-30	336	1028	337	1082
ACZ43418.1	5.72e-30	207	1028	214	1013
AVM45104.1	2.11e-26	329	1042	464	1125
SQI35982.1	2.58e-22	329	535	57	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZN2_A	1.38e-08	335	530	42	255	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.38e-08	335	530	42	255	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000209	0.999165	0.000160	0.000154	0.000148	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_03162.