CAZyme Information: MGYG000004501_00619

Basic Information

• Species: CAG-312 sp900760665
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760665
• CAZyme ID: MGYG000004501_00619
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734		83176.37	6.1888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004501	2469413	MAG	Israel	Asia

• Gene Location: Start: 35452; End: 37656 Strand: -

Full Sequence      

MVISKGELKLITSARCGLPHDLLGMHKCRGGIVVRAYVVNAKSCKLVDLRKPSAAPAEME
KLDPSGFFELFIKGARKPFPYRFRVERYDGRIDEFADPYSFPPTLSEDELYLFGKGDDRK
VYEHLGSRILEVGGVRGAAFAVWAPTARRVSVVGDFCEWDGRYFPMRQLGSSGVWEIFIP
GLGDGAKYKYEILAANGGAPFLKSDPYAARFEPPPNNASVVCDLSGYEWGDGEWMRRRAE
TDWSKRPVSVYEVHLGSWKRVPEDGFRPLTYVEIGEQLAEYCREMHFTHVEFMPLSEYPF
EGSWGYQVTGFYAPTHRYGTPREFMRMVDILHRNGIGVIMDWVPAHFPRDAFALAGFDGS
CLYEHEDPRLGANPDWGTLCFNYGRSEVANFLLGSALAWLDRFHIDGLRFDAVASMLYLN
FSRENWIPNKYGGSENIEAIEFLKRVNEIVHSEHAGAITVAEESTTFAGVTKPVAEGGLG
FDFKWNLGWMHDTLDYLKEDPINRKYHHNKMTFPSMFQFTEKFMLVYSHDEVVHGKSPMV
GKMGSGYWDDKIATLRALYAYMWMWPGKKTLFMGDEIAQGHEWRYDESLEWSLLKYIQHE
GVRKAVSDAAKLYLEDPKLAENDFNPIGFEWINADDGDNSVFSFLRFGSDGKKCYAVASN
FTPVELRSYRLGLPRGGEWKEVLNTDAACYGGGGRGNMGRVSAQKRKAANFRPYGCDLVL
PPLSTIVLSNDSAE

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	280	579	1.5e-141	0.9966777408637874
CBM48	125	210	4.8e-18	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	103	728	5	625	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	3	723	503	1215	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	100	728	1	626	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14706	PRK14706	0.0	100	728	2	619	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	3	728	1	721	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY37490.1	0.0	27	728	7	707
ADE53954.1	3.66e-311	25	724	1	704
QXD26686.1	1.32e-310	1	726	1	731
QXD22608.1	1.32e-310	1	726	1	731
QXD31563.1	2.11e-306	1	727	1	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQZ_A	8.00e-236	19	734	41	777	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	1.13e-235	19	734	41	777	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	2.27e-235	19	734	41	777	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	3.21e-235	19	734	41	777	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	6.44e-235	19	734	41	777	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q165E2	1.13e-263	1	731	1	729	1,4-alpha-glucan branching enzyme GlgB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) OX=375451 GN=glgB PE=3 SV=1
Q1D654	1.02e-262	7	726	13	729	1,4-alpha-glucan branching enzyme GlgB OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=glgB PE=3 SV=1
Q2W2Q6	1.26e-262	2	731	17	739	1,4-alpha-glucan branching enzyme GlgB OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=glgB PE=3 SV=1
Q1AZ86	2.04e-259	19	728	18	717	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
B3PGN4	3.39e-254	3	728	10	734	1,4-alpha-glucan branching enzyme GlgB OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004501_00619.