CAZyme Information: MGYG000004501_01892

Basic Information

• Species: CAG-312 sp900760665
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760665
• CAZyme ID: MGYG000004501_01892
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577		63596.54	8.5289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004501	2469413	MAG	Israel	Asia

• Gene Location: Start: 2609; End: 4342 Strand: +

Full Sequence      

MPYIAVFMKFLLLLTAVCAAQFARASETPKRPEEVFAPAVVGIPPADAVSGLCKMPDGKI
RHYNYGGQPENAVGGIYSNNVSNRMYIESSDGGFTWEKRQAGKGEEFGPFFHPESGRYFN
FLNIGGSAWFLDCGKDGKCVKKSQICPWPLEFNAEPLVVGKRILMPVTLRTSSSQKSNDF
VFGAIFLITDDFGKTWKKSGRLNVPHHKAGGIHKGTRWNHDAMEPSAVALKDGTLLCLLR
TSLDNLWQSRSKDGGMRWEKPVPTPFYGTCVMPKIGRLSDGRLLAMWSNATSLPEVEGAD
GVWEDVFTNRNAIHAAISEDDGKTWRGFREVLLDRRRDAGDFADARGADKSMHQSQFIEV
APGKILAAVGQNGMHRKLVMFDAGWLLENSRECDFSNGLDDWSVFNYKKGIRGHCAYNRI
AGCSLEDNPDSAGKKCMLIKYEPDESLVSDIRGAVWNFPAARKGEIALKAKFNKGFKGAK
IMLHDRWINPSDEVADTLALASIRLPESLGDGSTRDLRLKFDADAKTASLFDGDRKIAET
GIGRPAPIGISYLHIQSEKSKGDAGMLLLSVSEKGRP

Enzyme Prediction     

No EC number prediction in MGYG000004501_01892.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	79	327	8.5e-20	0.5350877192982456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.63e-20	162	331	157	299	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	3.32e-15	82	326	80	252	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	1.52e-06	190	381	53	228	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	0.001	225	325	17	125	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA17103.1	3.41e-150	13	568	12	550
QRX64725.1	1.80e-147	11	568	10	551
QCQ56765.1	1.49e-145	8	568	1	556
QKH87412.1	1.49e-145	8	568	1	556
QCQ39035.1	1.49e-145	8	568	1	556

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000212	0.999223	0.000166	0.000142	0.000126	0.000120

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004501_01892.