CAZyme Information: MGYG000004502_01020

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-451
• CAZyme ID: MGYG000004502_01020
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
951		104642.43	8.0799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004502	1382274	MAG	Israel	Asia

• Gene Location: Start: 17549; End: 20404 Strand: +

Full Sequence      

MKKKTKQKQNSNLMLIFLGAFLILMIISYFIIGWLLTAFLGVGILVIVGFAHLLDKVKNK
PKQKKILNIIIIIILSLGILVMLLGIAFLAYVVIKAPKFDVSQLNEKEPSILYDIDGNEF
ERLGTEMREKVTYDELPEVLVDAIVATEDSRFFQHNGFDAPRFLKASLGQMVGHSDAGGA
STLSMQVIKNSFTSADDHGIKGIIRKFTDIYLSVFKLEKNYTKEQIIEFYVNNHNLGGNI
YGVKQAALAYFNKDIGDLNLAEASIIAGMFKAPNLYKPTNTDNIKSVTRRRNTVLYLMER
HGYITSEEREMATSIPVESLVDYNVSAQNGLSKYQGYIDTVVDECIAKYKADPYTVSMKV
YTNLDRSKQDGVDRVMNGESYTWANDTIQSGVSVLDSATGKILAIGAGRNKKGAKELNLA
TSDEIKRQPGSTAKPLFDYGPLIEYNNASTYGYNDNGNYKLFIDEPYSYTNGKSINNWDG
TFMGAISMRKALSLSRNIPALKAFQQVDNKKIIEFVQNLGIEPEIENGKIHEAHALGAFT
GVNSLQMAAAYAAFSNGGYYNEPYSVSKVIFRDTGEEKKHEGVRRQAMSDSTAYMITSIL
DDVTLIGSGNLDRVAMKTGTTNFDEKTRATLGMSDDAIRDSWTIGYTTKTVIGMWYGYTS
ATKELVSQGLYCHNLKCSTQKDKLFAALAKEVFEKNKEEFKMPSSVVKLGIVAGSNPAKI
AGAGYSGAITYEYFKKGSEPTSTQTVEENLPAPTNLKAVYNSSNNTVSLSWNAVTPPSST
SSYGTFGYNVYFNNTLLGFTSNTSFTVTNQSNPYGTYKVIAAYKSYDGIKSNVATYELKK
TSSTLKVTYSPISTTSYNVSDIVKYVTVTENGNNVTSKASNWKLTSITGPGGVSVSTTTL
STPGTYTLRYEFTYDGEKKETGNITVTITGNNNGNGTDPGGDDNKDTETIE

Enzyme Prediction     

No EC number prediction in MGYG000004502_01020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	117	298	1e-51	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	2.00e-134	81	658	27	571	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.39e-87	84	749	20	773	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	6.39e-61	83	657	7	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	7.95e-61	116	299	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
PRK11636	mrcA	6.44e-39	82	569	15	595	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APH04640.1	3.83e-149	70	772	35	714
ASS91702.1	2.57e-145	70	772	31	708
AXI39978.1	2.64e-145	70	772	31	708
AWI12666.1	2.84e-145	58	844	17	782
BBU39970.1	5.07e-145	70	772	31	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	1.19e-78	104	706	2	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	4.14e-77	95	706	2	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	9.82e-53	216	664	2	438	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	1.25e-48	216	664	2	438	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2ZC5_B	1.24e-46	332	719	3	390	ChainB, Penicillin-binding protein 1A [unidentified],2ZC5_D Chain D, Penicillin-binding protein 1A [unidentified],2ZC6_B Chain B, Penicillin-binding protein 1A [unidentified],2ZC6_D Chain D, Penicillin-binding protein 1A [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	1.25e-121	85	772	52	728	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q04707	1.06e-88	59	719	2	653	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q00573	4.08e-88	59	671	2	613	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q8DR59	7.53e-88	59	719	2	653	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	1.71e-63	60	726	3	630	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	32
36	54
67	89