CAZyme Information: MGYG000004507_00220

Basic Information

• Species: CAG-460 sp000437355
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-460; CAG-460 sp000437355
• CAZyme ID: MGYG000004507_00220
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270	MGYG000004507_2|CGC1	31842.99	9.2045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004507	1191088	MAG	Israel	Asia

• Gene Location: Start: 11195; End: 12007 Strand: +

Full Sequence      

MNILYCGDTNIADGLIISILSLIKHEKDVLNIYVFSMDYDASKGVSKKAIQKLDDLVKSV
NKESFVKLIDVKEYFLSEIPSSNIDTMFTPYCMLRLYADLVPDMPSKIMYLDNDVVAYNS
FKSFYDLDNSKYEIVGARDFYGQYFYSKNKIRKDYLNSGVLILNLDLIRESGSFKKARNM
CQTRKMLLPDQAAINKYCKPKLIVKRKYNEQHTLKKDTVFRHFTTTFKFFPYFRTQKVKP
WNIDRLHEILKCHEFDDILESYQKLKEDIK

Enzyme Prediction     

No EC number prediction in MGYG000004507_00220.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	242	1.2e-30	0.867704280155642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	5.00e-33	1	243	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	1.85e-19	2	228	1	246	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	4.02e-19	1	230	3	244	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK15171	PRK15171	1.41e-08	1	223	26	263	lipopolysaccharide 3-alpha-galactosyltransferase.
cd00505	Glyco_transf_8	6.30e-05	5	166	6	163	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA31517.1	1.93e-88	1	270	1	274
ANK66321.1	1.57e-87	1	270	1	274
ANK63873.1	1.57e-87	1	270	1	274
ANK58884.1	1.57e-87	1	270	1	274
AVK99252.1	1.67e-87	1	266	1	270

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	3.86e-07	1	209	39	245	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
P19817	7.39e-06	1	217	26	241	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P19816	7.41e-06	2	242	29	273	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004507_00220.