CAZyme Information: MGYG000004513_00102

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_00102
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	MGYG000004513_2|CGC1	97808.8	5.8326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 24421; End: 27018 Strand: -

Full Sequence      

MKLRGDALREVSFPVGGIGAGCIGLAGNGRLIDWEIFNHAGKGLGNGCSHFAVRAERNGR
VEAARILHGDLLSDLSGERRGSDAMYYGFGWGPGEETLCGLPHFRDVVFDGEFPAAELTF
TDPDFPARARLTAWSPFVPGESDLASLPIALYEITLENSSDATYRYSCVGALVNPWQNPE
AENRVVQQKGLTQLLLDNHLPPDSFDYGELALSTDADEVSFQEHWYRGRWRDFLEVYWND
LNTPGAFRNRRYSGRTGAVKWDCGMLGAHFTLAPGERKTVRFLISWYIPNRRNTWDSNVE
EELRRSGLKENRWKNYYTRLCSGAGDAAQRFFPIWQESREKVFLFRRALHESTIPEASLQ
GAAANLSVLISPTCLRVEDGTLWGWEGVGPERGSCPGTCQHVWNYAQALPLLFPDLERSI
RESQAKYGFDENGGWQFRLRLPLGIRARAQWMRPCVDGSYGEVMKIYREWKISGDTKWLN
SIWFAVRQAIEYAWSPKNPDRWDPEQSGVITGRQHHTLDVEQFGPSGWLTGHYLGALKAA
AEMAPHCGDPAFGTLCAELLEKGRRWCEEHLFNGEYYQQAVDLHDPAQILPFLQGDETAE
HNPYWDAEHGEIKYQAGEGCEIDAHLGQWYASLYGIGEILAPERIHSTLRSVYRYNFRPS
LRKFANTWRTFSVDDEGGCIICVWPEGREKPVIPLPYNSETMTGFEWAVAAHLVMTGEPE
KGEELARAIRRRYDGRRRNPWNEIECGSNYARSMASYAMLQAYSGFCYDMVRGMIGFTPV
LSGDFRCFWSLGTVWGTFERSGQEQELHILYGEAEFSAFRIPAESAARNGTALAGKRKDG
EWIPAEPVRLRAGDRLTFSGTAVRV

Enzyme Prediction     

No EC number prediction in MGYG000004513_00102.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	456	759	5e-53	0.7272727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12215	Glyco_hydr_116N	4.04e-47	13	330	2	297	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	9.90e-35	402	759	19	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	1.41e-25	14	766	16	720	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
cd11756	GH94N_ChvB_NdvB_1_like	0.005	240	284	223	267	First GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This first of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW31016.1	9.30e-295	4	824	6	822
BAM01381.1	2.55e-291	4	822	39	859
AEE95836.1	3.08e-291	5	822	10	833
QHT59778.1	1.88e-288	2	838	4	835
AZN43107.1	3.61e-286	2	828	4	825

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7W2V_A	2.30e-15	14	754	102	817	ChainA, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11]
5FJS_A	3.79e-15	14	729	55	740	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	3.83e-15	14	729	58	743	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]
5BVU_A	3.84e-15	14	729	59	744	Crystalstructure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],5BX2_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with 2-deoxy-2-fluoroglucoside [Thermoanaerobacterium xylanolyticum LX-11],5BX3_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with deoxynojirimycin [Thermoanaerobacterium xylanolyticum LX-11],5BX4_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with Glucoimidazole [Thermoanaerobacterium xylanolyticum LX-11],5BX5_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with glucose [Thermoanaerobacterium xylanolyticum LX-11],5NCX_A Crystal structure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase with an covalent inhibitor [Thermoanaerobacterium xylanolyticum LX-11],5OST_A Beta-glucosidase from Thermoanaerobacterium xylolyticum GH116 in complex with Gluco-1H-imidazole [Thermoanaerobacterium xylanolyticum LX-11]
7W2W_A	3.98e-15	14	729	102	787	ChainA, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11],7W2X_A Chain A, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.949497	0.016985	0.033332	0.000052	0.000031	0.000098

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_00102.