CAZyme Information: MGYG000004513_01286

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_01286
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		42671.27	9.6547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 77; End: 1183 Strand: +

Full Sequence      

MFPRINRDHRAVYSGTLANTPPLRGVMSPHKFTEEDFRTLKAWNVNLVRAQITRRWGQFD
TDQDLEEYDRWFDGKLAHLEQALQWAGKYGIKMIFDMHTPPGGRNRQREMTMFFKKKYAD
HYIRCWERVAKRFKGNPAVLGYDLLNEPVQQRRAPYDYWNIQRMAAEAIRGIDPDAVIIV
ESNLWAAPATFQYLSPLKMDNVIYQVHMYQPGAFTHQGVNNAFGEQGKRILVRYPGTIGG
TYWDRNALRRVLQPVRDFQLRHNARILVGEFSAIAWAPGAEQYLADCIAIFEEYGWDWTY
HAFREWRGWSVEHAGPDSGHLVPSPDNPRRRVLLEAFQKNRPFPAEAVSGGERGAGERNS
AGEVRRGN

Enzyme Prediction     

No EC number prediction in MGYG000004513_01286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	30	308	1.3e-45	0.7454545454545455

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.31e-27	23	301	10	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.22e-17	33	313	75	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45719.1	1.06e-169	1	339	211	549
AVM46198.1	1.24e-163	1	341	161	501
AVM45721.1	7.90e-151	4	340	184	514
AVM45720.1	3.38e-145	4	341	231	563
AVM46390.1	6.94e-144	1	341	162	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	4.91e-24	33	300	30	315	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.27e-23	33	300	30	315	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6KDD_A	2.62e-16	31	303	41	295	endoglucanase[Fervidobacterium pennivorans DSM 9078]
3NCO_A	1.57e-15	34	303	44	295	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
3AMC_A	2.07e-15	69	303	70	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	1.96e-23	33	300	30	315	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	1.96e-23	33	300	30	315	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	3.69e-23	33	300	30	315	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	3.56e-16	34	218	33	211	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
W8QRE4	2.06e-13	32	214	71	253	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_01286.