CAZyme Information: MGYG000004513_01316

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_01316
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		58439.24	9.0186

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 14442; End: 15977 Strand: -

Full Sequence      

MIGQFARLTAILFGAVCTTLPAASQPEPLPLKFEDSKWRLGKFASIKDGILTIDVPNTPE
KNGQNFATCPIDLTPLRNQSISVTVNTKGTNISIPTRNWNGGKVMLHYRDENGMDHWHHP
TRITGSFDWRDIGFSAPISAGATKGQLHLGLQQSSGKIEFKLDSIKVYTLFPRVNEDYKI
AYPDRIRNTAPLRGVMSPHRFKEDDFKTLKEWNVNLVRAQLTRAWGKTGTDRDLAEYDRW
LNRKLDHLEEALKLAEKYGIKMVIDLHSPPGGRSTGRDMNMFYEKKYADHFIECWKRIAQ
RFKGNPAVWAYDLINEPVQNRPAKYDYWNLQRMAAEAVREIDPDTPIIIESNRWAAPASY
SYLSPLAMDNVIYQVHMYAPGTFTHQGVNNTFGEQGKGVGVTYPGFIEGRQWNKEMIRQT
LQPVRDFQLQHNARIFVGEFSAIAWAPGAAKYLADCIDVFEEYGWDWTYHAFREWKGWSV
EHEGTDAGSLKPSADNDRKQTLLKAFQKNSR

Enzyme Prediction     

No EC number prediction in MGYG000004513_01316.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	200	478	6.7e-46	0.7454545454545455

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.39e-27	203	470	27	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.21e-19	202	500	75	390	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	0.001	190	356	26	167	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45719.1	4.97e-233	36	508	72	549
AVM46198.1	1.70e-218	4	509	2	500
AVM45721.1	2.61e-197	8	510	10	515
AVM45720.1	1.47e-190	5	509	55	562
AVM46390.1	1.07e-183	16	509	14	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RJY_A	3.27e-22	190	472	32	295	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]
3RJX_A	3.27e-22	190	472	32	295	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]
3NCO_A	3.27e-22	190	472	32	295	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
7EC9_A	2.43e-15	188	461	24	295	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
3AMC_A	3.42e-15	241	472	69	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16169	4.10e-14	202	391	32	215	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
W8QRE4	6.59e-12	247	379	112	249	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
P14250	3.15e-09	229	387	367	521	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2
P23548	2.54e-08	192	390	71	287	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
B0XN12	1.46e-07	193	349	85	245	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002109	0.888247	0.108198	0.000795	0.000342	0.000291

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_01316.