CAZyme Information: MGYG000004513_01376

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_01376
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504		59070.34	9.7334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 10793; End: 12307 Strand: -

Full Sequence      

MMKYKNLLCNVILFAALAGNAESLNLKWNLCREAKLSEGRFLKFSVSPENKSGQHCASAE
FDLSSSADCMIEFSIRARAKNVSRPPQEWNGVKFMLHYRDSAGKDFWPGIRKFSGTFDWQ
ELSFFALVGKPQGKAFLKLGLQDSSGEVEFDLASLRFHKLFSPPNRQFTARYSDEIRATP
PLRGMMSPARNLTKDDFATLRSWNVNLVRAQIIRNWHKVGTDRDLEEFDRWINRKLDHFE
TMFRIGYEQYGIRFVIDLHTYPGGRYANREMAMFHETRYAEYFVELWKKIALRFRNNPAV
WGYGLINEPNQKRFARHDFETLQKQAAEEIRKIDSTRPIIIAANLSNSPDTFHLLKPVDL
LNIIYEVHMYQPFQFTHQRVYSKDGKLRPGEKPVVYPGLINGEEFDQKKLRQILQPVRDF
QLRYGARIYVGEFSAITWAPGAAQYLHDLIEIFEDYHWDWSYHAFREASVWDVEKAGPDH
RNIRPAPNTDRKQVLLEGFRKNRR

Enzyme Prediction     

No EC number prediction in MGYG000004513_01376.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	189	468	6.5e-35	0.7418181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.70e-20	193	463	26	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.06e-13	192	475	74	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46390.1	2.06e-211	12	503	11	503
AVM46198.1	5.78e-168	2	503	1	501
AVM45719.1	9.37e-167	27	501	73	549
AVM45721.1	2.95e-143	38	502	54	514
AVM43579.1	4.94e-142	17	502	42	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.22e-20	248	497	79	333	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.65e-20	248	497	79	333	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
7EC9_A	5.94e-14	191	454	36	295	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	2.56e-13	191	454	36	295	Crystalstructure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]
3AMC_A	3.73e-13	251	498	87	313	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	8.09e-21	248	497	79	333	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	8.09e-21	248	497	79	333	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	1.22e-19	248	497	79	333	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	1.39e-11	194	436	33	262	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P14250	7.96e-07	187	378	335	520	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000308	0.999011	0.000163	0.000171	0.000155	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_01376.