CAZyme Information: MGYG000004513_01392

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_01392
• CAZy Family: GH167
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1366		153599.16	8.496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 6154; End: 10254 Strand: +

Full Sequence      

MKRFPTPGGSSAAVIGAILLASVCAAENVVRNGSFEMLRADKNPQNWSFEVWRQAPVTLE
VVPEGFSGKNALRITNSMEKKKPHVFGSCNQRIRLAPDTDYIFSFKGKGDPGSEIIMICG
KSWTTRKTFAFTGRWQQFGARFRLSPKELEKDGSTYLRLNSDKFCGNVLIDDVQVVPKGD
VILDNGDLEGLPGDVPWGWRFFCSRNAQCTAALNRDGQLLIQNRTPARPHVFGGLEQWIR
LTPGQPYDVKIRYKCDSEANQLALGLKWQTRLKLPASPEWKEMVFRITAPLETRPDGTIP
FLFLCDDVSQETLLDSISIEPVGKTEFPAADWQDQRLYGVPRFEGDFDKLQSIPRELPVL
SLPRSAQEVASGRMPDSRSLSARVAMGADPRGLLFFAEVKDDLCVTVPGEEMWRGDSVQL
RIDCGAYGAASEMPTDLEVTFSVGQDGKPYAWCNVAGRDNSRLAGKALPSTLCRLTGRRE
GGSYFIAARLDWSLLKPVDPKTQPWFGFTAVVNDSDRTGEREIAFLTPGLHDAKYSNCYF
NAMLPTSRPEFRLLPGKDASPDFLGGELLAAGLQGSCRFSAEWRDSSGKIHQGEIGTVEV
TSAENLLKQPFQLRLPAGFEGRYHLTLRVNGRKVLEQEGSKLSPEREAAENINRLLARLD
RTNRAIDALERKGKRSHYLSVPRKILNLHLPEIAGRFNAAKREGERNYYARQINMITPEC
QELFSEMEANIRKLENGGTLPQTWSYRSSPIRLVDGWPTAVAENESGRRETRPIVCAGYG
HFEHIDRDITFLRELGVNTVTVEIGPRMVFPKEGRSHEFEPDFTYFDNRYNSLLQKAWEN
DIQVCLLVSPHYCPKWLLDKYPDMKIPERPNRKPGFIRYEITHPKAQEMIRRYLNALIPH
LKKNPYAKAIHSICMSNEPEYLYSWPDNPVTVRNFTAWMEKKFGSIARFNAETGKNYPNF
AAVVAAESKETAASYIFRDFVRETYAAWHRNFADEVRRLWPGVKVHSKIMISFSPYTYVS
GVDPELWAEFSDLNGNDNICMQGGRYASDMAGVILGDEIQISSKKVSVVNSENHIIVDGE
TKPISNDHIYASVFEQFATGAATVLTWVYHDVLYDFSVKYPKEARLGCIYMRPGNLAAHA
RAVLDGMRLAPELKRFMQYEPDVAFLYSPTSAMLHSRNGCLYPMSNLALQLASTGYRARA
LTERQLAAKKFGATRLLFVAGAPNITRASLAGLKKFAQEGGRIIADPLSLKQDEYGRPLA
LDFPVERVKDFTSENTAQLIASTPAVLKLPFGVSAGEKGMDGILFRAVPDGNGSWLVNLM
NYNHDRRMIALRGNGTWHDLLEEEPASTGFPLESRKIRMLRFTPKK

Enzyme Prediction     

No EC number prediction in MGYG000004513_01392.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH167	757	1361	5e-108	0.8535564853556485

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.09e-16	380	544	28	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
COG1874	GanA	3.56e-14	781	1316	23	573	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
cd09619	CBM9_like_4	3.23e-12	362	537	18	182	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam02449	Glyco_hydro_42	1.47e-11	783	1038	10	261	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
cd00241	DOMON_like	2.04e-10	379	521	17	153	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43323.1	0.0	2	1364	5	1358
AVM46829.1	4.60e-206	185	1364	26	1182
AVM43886.1	5.40e-117	585	1360	232	996
AHF94331.1	3.80e-86	15	1364	15	1383
AZN41326.1	1.78e-69	361	1323	497	1429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PTM_A	1.03e-17	834	1334	216	741	Crystalstructure of apo exo-carrageenase GH42 from Bacteroides ovatus [Bacteroides ovatus CL02T12C04]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.025148	0.441500	0.531622	0.001136	0.000310	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_01392.