CAZyme Information: MGYG000004513_01687

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_01687
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870		97453.31	7.8705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 3759; End: 6371 Strand: -

Full Sequence      

MRIVINVLFGLMFLNAVAAEPLFQCRSNAIGNIQYTGREIVLDLRFENRGAFSGKFTELL
RICDVHGNGQAPEIRHVMLEQGTTLTRRVTIPADYRGMFRIVYSLMCDGELFFSRSITGI
VFTPVEQLDPTGSPIGMYCHNVQINGKQELPVLKKMGIRWIRANLLWELLEPKHGSFEWS
SGDASYNALTGNDMNIMYNLVYPPRWAVNRVNIYGGNPADFERFAAFAARAAARYPAVKY
WSVWNEPDAESHWEGGGAEFARLLKVIAPAIRTANPAAKILPGGVTGSPPLAERFYRDLQ
RAGGRPFFDIYEYHYRNVDLHRNLIREFGWEDMPLWNTEAAEGEKGAAHLVREVISGFAA
GVKRTFVFLYAIEKKSPADFEEFGPVVMVDNEGRPTENFPVVYTMSREINGIRSCEDRSG
KNLALFAWRNLTGEERYILWGKGDTRAVTLRSSGPLRAVDAVGNERILSPFDGYVSTPAT
EVTYLSGAEVIPAGEPMAELGNPCSTPVFGTEFQIPVRFRNPSSRPFRGKALLAASPDWE
IPTVEIPLELPPGESREILCRLKPRRLTDASASRLTLQLFREDGALSACDQRDINLTTAL
GLSLRSAFRWGEPRVRALINNPTAAPIEAEIRFRSLGKNGKTAAMPVTLPPLTTSSVYFN
PGLKAGEVHGRAEALLTYPGGAVRRVAELDWIALKPAGNPPIVLNRRTDYIAPSRILFQW
EGPQDLSVKVKLGWNPEHLLFFAEVTDDVHSAETDPGLLWQRDSIQFWFDGMLFDLGLTS
KGAVLHRHDVRSKQMKIPFSVTRQGNITRYQIAFPRLDGNQWRENDTVAFAFIVNDADRG
AERKGWMHYLSNIGEPRCRAVTPELTLVKE

Enzyme Prediction     

No EC number prediction in MGYG000004513_01687.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	173	321	2e-20	0.37819025522041766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.94e-27	700	857	1	178	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	2.94e-11	720	840	12	150	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	1.78e-06	720	770	30	80	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00005	CBM9_like_1	0.002	729	845	40	161	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47094.1	3.80e-117	20	868	227	1070
AVM44950.1	3.50e-38	124	854	316	1089
QTH43804.1	5.91e-25	126	857	319	1103
QTH43245.1	8.34e-24	86	868	456	1282
QJD82799.1	1.44e-23	88	868	458	1282

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000213	0.999224	0.000138	0.000144	0.000127	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_01687.