CAZyme Information: MGYG000004513_02087

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_02087
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984	MGYG000004513_87|CGC1	110695.44	8.9132

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 7579; End: 10533 Strand: +

Full Sequence      

MKLFFKALISFLLTTTIVRAESASAKWQPLLPAQTVNNWRVYHGAEFPGARGKLTEEPDG
GLLLSGEFEDRGVYVAAALKLRITNPGTRINLTAVTDCRIALRCQDRNGHYRQTAAIPLK
ANEKYILSVTPDQEWPICWGGAEKGKQPVFPYRSIQINAMRMPKSPEVKLRIDDVQVPRG
QVFLEPVATPVQFLSAQEAPSPRLVLCNIKEKTLRISGEIQMIAYNGSFRTIKVDQEVPA
HETHEIALPIPEKRQGSWRIAWNLTDHESGNHVAGEDRFSRMIPAGPAATGKPADFLFGI
AAHPENYSTREREKMAEAAALCGAHLIRTNARWTYQIQPKPDVWDYQILDSVVDVFSGKG
VGIQLILSGCPNWAVAKEWRPKNPATKRPTWGRRPDYAAWRNFVRKTVRRYADRIHLYEI
WNEPDLISFANFSTEEYLQLQEIAFQEIKKVSPNLKVISGGLSGYLPAREELFRRIAQSS
TSDIFAFHCHGWLGSYLEQIKELRRILKEYPKPWYSNETAISSLSCGEYQQAASLFKKLF
TAWENGSIGYTWYNLREKGNNPRDSEHHYGMLTYDFKAKPVYLTFNTLTTLFRGAQREGN
FPLASELTAGCFRAADGDLLIPFWQSNLISESLYAIGEIASDKAELIDLMGNRCSIPVKE
GMAVIKGSSEPRVLRIPAQAGRPLPLGNLIFTPAVLPVTLGGESTWEFRFRNPSQRPLHW
KCSIELPEFVTASYPSKIDLGPGKEKILRIKAQTSSEFSSVASSRRIASLKLGGETLQIP
LQGKITLPWKKFPEVAQLQLRHADQVTPLIENEPQTAHLFWHGTDDLSAEIRLARDSENL
KLKLNVTDDHHVVKHFNDEAWKSDGVQIGIAMNHQKGIWKIGLSHPAPGQSAVFIWSAPD
GFNPKDAATKIRLKSSRDEKKKQTVYEVEIPCETIGLNPQTTESFRFNVLINDNDGEIRE
SYIALAPGLGDRLDAGGYPVIHLR

Enzyme Prediction     

No EC number prediction in MGYG000004513_02087.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	342	625	6.1e-32	0.7215777262180975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.35e-60	796	983	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	4.10e-13	821	979	30	183	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	6.36e-11	819	965	10	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam01229	Glyco_hydro_39	1.04e-10	396	591	123	350	Glycosyl hydrolases family 39.
pfam06452	CBM9_1	4.65e-09	824	964	28	161	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	3.51e-155	100	981	128	1030
AHF90198.1	1.00e-133	242	981	255	1003
AVM46276.1	5.16e-126	189	981	336	1134
AVM44759.1	1.39e-125	203	981	180	962
AVM47149.1	1.91e-107	256	981	567	1304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.51e-12	180	674	9	496	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.998978	0.000204	0.000173	0.000164	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_02087.