CAZyme Information: MGYG000004513_02183

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_02183
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688		78154.81	6.415

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 5666; End: 7732 Strand: +

Full Sequence      

MNLGVQYYRAPFPDAKYWEEDFRRIRESGLNTVQLWISWGWVEATPDRFVYDDYDRLVEL
AGKHHLGLVLSTIAEIQPNWIHRVIPGCELVDNRGNRIRSVARCEHHFGLTPGGCTDHPE
VWRRMARFLEMTGRRYAGLAHLRGWDVWNELRWNVHADAPVCYCEHTLAAFRDWLKERFG
SLEGLNAAWKRRYAEWVDVEPGRGPDLPYTEMIAFEEFICARAAAHARRRYEILKAADPE
HPVTAHAADPSPLMAGGATEFAVNRGNDWALAEVLDGIGCSSFPQWAGIDDADFGMRIDM
VRSAAGKKKLWLSELQGGRAAVGFEIFGKVHASRQQRWLWNGLASGADTLLIWCWRDEVF
GRESSGFGLDGNDGLAPERLEAMKITGSLWEKHAALFDHYRPDPAAVGILFSPQSYFLDW
AQEANAARMRDALTGYARALTRNSVPCRFLEATRTECFRECKIIFLPRVPVLDPAQEEAL
LEFVREGGVLFAESEAGAFSSAGFYRYPEDRFTVPAGVVEIGRRTLEEEWLSVEMEGFRY
RLKGDQWLTPPVGAAPDELFSVRKFGQGRIIYCGTYLGNAYRRTPYADFERLIRDLVRLA
EATPAIEVISPPPEPDNFLYLKYGRSEGKSLLFVFFPPKTPVAELRIGGEHFRSGRAVEL
FSGRKYEIRKGKLVAEPGRFRIAVLAEE

Enzyme Prediction     

No EC number prediction in MGYG000004513_02183.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	7	380	4.3e-70	0.9622641509433962

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	4.57e-36	18	379	12	361	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	1.09e-18	3	520	18	523	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
cd03143	A4_beta-galactosidase_middle_domain	1.27e-05	407	600	1	152	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam01301	Glyco_hydro_35	5.34e-05	7	70	18	81	Glycosyl hydrolases family 35.
pfam08532	Glyco_hydro_42M	0.004	405	597	1	205	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF92860.1	5.97e-232	1	686	1	704
AHF93732.1	7.86e-224	1	664	1	726
AHF93313.1	6.74e-214	1	687	1	786
QJU55110.1	8.89e-168	1	640	1	649
ADB53485.1	1.38e-153	1	670	1	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KWG_A	4.32e-29	3	468	2	484	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
6LVW_A	5.38e-29	1	379	1	375	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
6Y2K_A	1.37e-20	1	382	1	376	ChainA, beta-galactosidase [Marinomonas sp. ef1]
5E9A_A	7.08e-15	21	296	60	315	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
4UOQ_A	2.10e-14	3	491	25	501	Nucleophilemutant (E324A) of beta-(1,6)-galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis Bl-04],4UOQ_B Nucleophile mutant (E324A) of beta-(1,6)-galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis Bl-04],4UOQ_C Nucleophile mutant (E324A) of beta-(1,6)-galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 [Bifidobacterium animalis subsp. lactis Bl-04],4UOZ_A beta-(1,6)-galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 nucleophile mutant E324A in complex with galactose [Bifidobacterium animalis subsp. lactis Bl-04],4UOZ_B beta-(1,6)-galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 nucleophile mutant E324A in complex with galactose [Bifidobacterium animalis subsp. lactis Bl-04],4UOZ_C beta-(1,6)-galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 nucleophile mutant E324A in complex with galactose [Bifidobacterium animalis subsp. lactis Bl-04]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O69315	2.37e-28	3	468	2	484	Beta-galactosidase OS=Thermus thermophilus OX=274 PE=1 SV=1
B9LW38	2.94e-28	1	379	1	375	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
D5JGG0	1.08e-27	14	607	20	601	Beta-galactosidase LacZ OS=Weizmannia coagulans OX=1398 GN=lacZ PE=3 SV=1
O54315	1.32e-27	3	373	2	370	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1
Q8GEA9	1.75e-27	3	389	2	387	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999974	0.000065	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_02183.