CAZyme Information: MGYG000004513_02767

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_02767
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	MGYG000004513_155|CGC1	71149.48	8.9535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 6353; End: 8218 Strand: +

Full Sequence      

MFSGVTGKIAASMMVMMMLGVVRSAESPYGICAHVSRGELEIAPQEFERMKEIGIRWVRT
DFDWNGVNPVPGKWNFNRLDQLLRLAEDDGMNILPILDYDVAWARPAYRHLDAWGEYVSR
TVRRYGDRLRTWEVYNEPNLQVFWRDKPSGANYTALLKRAYEEIKKVSPELVVLYGGTSG
VPLDYIEESFAAGAGNYFDVMNIHPYHWQGTPERMIEQIRNLKQLMKKYNINKPIWITEV
GWSTAQPPKLYREILPAAFLRAGIDPSRSTISVVDDPGRKFTGTRKFNPEYNLGIFRNVE
RIRLDQLKDLDPARSPALMPAIGEEFPGEYIPDLLAYVRKGGTLLLPSGLPFYYDLRRNG
DSYRRVQVNEKYMPMFHLGWEAWWTDNRVPQKESYQKPAPEFSGKFQVDFRPSSRFLHDR
NLKPGDQFIPLVEAGTDSYKGVVAALYKLNSDLKGNIIVCTMLSVCETVSEQQQAEMLPR
TYLIALAYGIPRIFWYNFRSDERAPDQREGHFGIVRKNQLEPKASFHAYRTLAGFCPAGA
SRPSLSLKQGVFCAFWTRPDGKKVWALWTEQQPREVKLSLRGEATEIADHLGRRISLPRA
IPAAPVYLVGPEEVAIDSPER

Enzyme Prediction     

No EC number prediction in MGYG000004513_02767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	76	247	1.6e-27	0.48259860788863107

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	2.44e-08	109	247	122	280	Glycosyl hydrolases family 39.
pfam07745	Glyco_hydro_53	5.16e-07	47	242	30	239	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
pfam02449	Glyco_hydro_42	1.25e-06	41	94	10	64	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam11790	Glyco_hydro_cc	2.64e-05	135	239	70	168	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
COG3867	GanB	1.84e-04	47	243	69	286	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44885.1	1.20e-290	26	617	26	617
QDU57372.1	1.21e-111	20	618	21	632
AVM44901.1	5.93e-85	10	586	8	599
AHF90941.1	8.01e-59	26	604	231	839
ACZ43011.1	1.04e-38	27	260	302	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	4.48e-14	30	244	107	345	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
4ZN2_A	4.45e-13	45	255	37	266	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	4.45e-13	45	255	37	266	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]
1W91_A	9.20e-07	118	260	138	299	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	9.20e-07	118	260	138	299	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	5.05e-06	118	260	138	301	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000371	0.998993	0.000203	0.000146	0.000134	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_02767.