CAZyme Information: MGYG000004513_03229

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_03229
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		94157.5	7.3242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 289; End: 2754 Strand: +

Full Sequence      

MKNFIDLSGEWSLKSPEWENGRTIPATLPGDNYSALLEAGAIPDPYFGSNETIVQEFRKY
EWEFEREFEVPSSLLEYDSVYLNVEQLDTFGTIFINGHRVLTGNNMFRRYRPEVKAALKA
GRNVIRIHFKSAELEAKKEALRQKREIPMNSCSKVPHLNLIRKVHCHGGWDWGITLMVTG
VYAPLTLTGVNLARIDFVHAVQKHEKNRVAVTAVAELSALRSGRKTVTFTFNGETKTVTA
TLKKGENRVKALFIVENPKLWWPNGLGEAVLYPLTVSTDDESVEQEIGLRTIEVVNQPDE
YGVSMYFRVNGFDVFCKGADWIPADAMPARVTTAVLDDLLESARLANMNMLRVWGGGQYE
SEEFYRLCDRKGLLIWQDMMFACSLYPSNEEFIETVRQELNFQIRRLRHHPCLALWCGDN
EVIGATGWYGKDKRLVNTIHYDRLNRELARMVATLDPERMFWPSSPCGGPNSFNDGWHDD
SCGDMHYWEVWHGGREFSAYYSVKPRFCSEFGYQSFPSLETVKRFCPPEQFNVFSPVMDH
HQKCVRGNAPIIGMFGKYFRMPESFENFLYLSQVQQALAIKTGVEFWRSLKPRCMGTIFW
QLNDDWPVASWASIEYGGKWKQLQYHAKRFFAPVLGVLYQDETKVLRLHLVSDLPVKATA
TVTAVAYDFDGKELRRFELSAPLRPNENRRLKSFKASELIGLDPDASFVELVTVAETADG
RRFRHENTFFFAPFKRCDLRKAALQVKVDEKGGRYFCRLTTDKPAFFVTLDTPGIPGIFS
DNSVTLLPETPVELEFTPKRKTSLKELQKTLAVNDLRSTYN

Enzyme Prediction     

No EC number prediction in MGYG000004513_03229.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	689	8.3e-96	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	7.07e-116	1	772	9	763	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	8.96e-19	741	817	1	77	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	9.59e-12	646	735	3	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	7.45e-08	193	290	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	7.79e-07	211	421	187	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44113.1	0.0	1	821	1	822
QDU34180.1	2.21e-273	3	820	9	835
QQE12237.1	2.11e-264	5	820	11	829
AYV24530.1	3.70e-240	5	820	4	804
ASI92427.1	7.41e-240	5	820	4	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.19e-153	5	819	6	853	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.23e-153	5	819	6	853	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	8.75e-153	5	819	4	851	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	9.00e-153	5	819	6	853	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	3.10e-149	5	820	11	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	1.52e-139	5	820	23	879	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	8.36e-134	5	820	23	879	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q4FZV0	3.53e-127	7	820	25	881	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q8K2I4	8.24e-123	7	820	25	879	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
O00462	3.16e-122	7	820	25	879	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_03229.