CAZyme Information: MGYG000004515_00095

Basic Information

• Species: UMGS1663 sp900753245
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1663; UMGS1663 sp900753245
• CAZyme ID: MGYG000004515_00095
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		47490.65	7.1983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004515	1468039	MAG	Israel	Asia

• Gene Location: Start: 89754; End: 90983 Strand: +

Full Sequence      

MEYLYIIQQALVWLVTIFWLYQLIVSICSLIKLKDKPILEEKENRFMAIIPAHNEAAVVA
NLVESLKKQNYPRELYDIYVIADNCTDNTAEVARNAGAIVYERFDEEKKTKGFALQWFLA
QKIKEDAPYDALCIFDADNIADENFLKAMNKKLCQGETVVQGYRDIKNPTDNWITAGYAI
FYWTMNRFYHLARYNLGLSPLLNGTGFMVKFDVIKPTGWDTNTLTEDIEFSLKNIIEGRR
LGWATDAIVYDEQPTGFKQSWSQRSRWTVGHIQCIKEYTGLLATAVKEKKTFMNFDGLLY
ILGSIPMFVVTIILLLLNFIIYFANGMTATDLLINCLRYFIPTFILPILTAILIMVLDRR
PIKPMIKGLMFYPLFLGSWLLINFKCLFVRETKWEKIDHVRDIKINEVN

Enzyme Prediction     

No EC number prediction in MGYG000004515_00095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	45	270	4.1e-26	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	8.18e-93	49	230	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	1.18e-48	49	227	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.01e-43	10	389	16	399	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	1.26e-21	44	267	2	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06427	CESA_like_2	5.09e-19	49	273	6	232	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ24461.1	1.17e-110	14	408	17	409
BCI60981.1	5.50e-109	6	408	10	413
QWT55360.1	1.07e-107	20	408	23	413
BBB93061.1	9.81e-100	15	408	16	407
AVQ53763.1	7.71e-97	8	408	12	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	9.48e-16	49	296	54	302	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8YMK0	2.13e-12	49	282	111	345	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	8.96e-12	49	282	111	345	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q47536	4.06e-10	33	311	21	292	Uncharacterized glycosyltransferase YaiP OS=Escherichia coli (strain K12) OX=83333 GN=yaiP PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31
299	321
334	356
371	389