CAZyme Information: MGYG000004516_00017

Basic Information

• Species: Sneathia amnii
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Leptotrichiaceae; Sneathia; Sneathia amnii
• CAZyme ID: MGYG000004516_00017
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000004516_1|CGC1	28699.5	9.3738

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004516	1228854	MAG	Israel	Asia

• Gene Location: Start: 18627; End: 19340 Strand: +

Full Sequence      

MERIPRVAYYIWIGDKKKPKIFYQCLDSWKKYLKDFKIIEINEKNIDLNKYMENRFFKEC
YQKKLWAYCSDYIRTDILYNNGGIYLDIDMQILRPIDDLLSYDFFIGYESNEYLGVGLYG
ASKNCVILKDLLEFYNQDIYTKSLWTIPKILTSIVKEKGYFNLENTKYLEERLFYPFSLN
EKFTNDCIKKDTYAIHWWNASWSNLRSKLFLETKHLSGIKKILKKIKIVLRVYLKGY

Enzyme Prediction     

No EC number prediction in MGYG000004516_00017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	23	101	5.9e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	3.65e-19	4	218	82	297	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.51e-09	19	105	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.48e-05	10	137	49	190	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKC95675.1	4.52e-179	1	237	1	237
BBM45972.1	2.21e-91	4	235	2	252
ALA95449.1	3.20e-89	4	234	2	244
BBM58848.1	8.13e-89	4	235	2	252
AMD95958.1	9.91e-89	4	235	2	258

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004516_00017.