CAZyme Information: MGYG000004518_00648

Basic Information

• Species: Zag111 sp002103105
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp002103105
• CAZyme ID: MGYG000004518_00648
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000004518_2|CGC1	25040.41	10.6845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004518	1841689	MAG	Israel	Asia

• Gene Location: Start: 48881; End: 49576 Strand: -

Full Sequence      

MKKLLLFTIALVLMLFAQVQAANVNTVKAAIVKHSIEMGVDPAITLSIAKTESGFRHEAR
SSHGAVGVFQLMPSTARRMGLNPYSLDDNIKGGIMYYKSMYKMFGSMELALAAYNAGPAN
VKKYRAVPPFTETRRFVAKITADYRHFKAHPDPAMIAYKGGSVKTISGSRPAIIAQSPSK
VTPKTPAGAAKMVAKTAPLPVSRIEESRRYNAELIKGLPAEVELKSQSVAI

Enzyme Prediction     

No EC number prediction in MGYG000004518_00648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	39	148	9.1e-28	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.79e-39	28	145	5	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.77e-36	42	145	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.82e-33	28	144	7	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	3.52e-26	31	126	1	104	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16894	MltD-like	6.58e-25	52	142	17	126	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	4.60e-80	1	231	1	216
AZT90545.1	5.15e-31	33	147	101	219
ADL42254.1	5.22e-30	37	150	101	215
ABP67307.1	5.63e-30	33	140	101	209
AEM73677.1	1.60e-29	37	149	106	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.02e-13	24	149	413	557	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.02e-13	24	149	417	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.03e-13	24	149	423	567	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.04e-13	24	149	427	571	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.04e-13	24	149	433	577	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	8.12e-27	26	144	59	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	6.13e-24	40	144	1435	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	6.13e-24	40	144	1435	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	4.05e-08	35	117	15	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000229	0.999113	0.000173	0.000170	0.000157	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004518_00648.