CAZyme Information: MGYG000004520_01944

Basic Information

• Species: Ruminococcus_E bromii_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Ruminococcus_E; Ruminococcus_E bromii_A
• CAZyme ID: MGYG000004520_01944
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		63512.41	8.0153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004520	2155170	MAG	Israel	Asia

• Gene Location: Start: 593; End: 2356 Strand: +

Full Sequence      

MADIKTRDAVKGTIKTIDKAAIATERMKSAYAKTKDKAEQGYYADESSATEYAADRLSYG
ADRIKDEGIHQFNKQGQKAVKKTRENIGKAKDKISAYKQKKATKAAEQHNNGLQIRHGAA
SRSSAPDSVQRAKSQFIKTRQQGNKTVKTTARNAEKTVKATAKGTVKTTQKSVKTAQATS
KAAIKTAEHSAKATKAAAKASAKAAQRAAQAAKATAKATVTAVKAAVKATIAAVKAIIAG
VKALVAAIAAGGWIAVVIIIVICLIALIAGSVFGIFFSGEDSGNGMTMQSVVREINAEYD
TRLDEIQSSTTYDVLEMSGSRAVWKEVLAVYSVKTATDQDNPQEVATMDENKKQLLSNIF
WKMNEISSHTESKTETAITESDDGHGNIVQTETTVTQTYLYITVSHRTADEMADLYGFNE
EQRQQLSELLAEENNSLWSAVLYGISVGDDEIVTVALSQVGNVGGQPYWSWYGFDGRVEW
CACFVSWCANECGYIDSGVIPKFAGCVNGVQWFKDRGQWQDSSFEPSAGQIIFFDWECDG
EVDHVGIVEKCENGIVYTVEGNSGDACRQKQYAVGSSVIYGYGIPAY

Enzyme Prediction     

No EC number prediction in MGYG000004520_01944.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05257	CHAP	1.25e-15	472	562	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
pfam04012	PspA_IM30	7.76e-04	4	141	40	174	PspA/IM30 family. This family includes PspA a protein that suppresses sigma54-dependent transcription. The PspA protein, a negative regulator of the Escherichia coli phage shock psp operon, is produced when virulence factors are exported through secretins in many Gram-negative pathogenic bacteria and its homolog in plants, VIPP1, plays a critical role in thylakoid biogenesis, essential for photosynthesis. Activation of transcription by the enhancer-dependent bacterial sigma(54) containing RNA polymerase occurs through ATP hydrolysis-driven protein conformational changes enabled by activator proteins that belong to the large AAA(+) mechanochemical protein family. It has been shown that PspA directly and specifically acts upon and binds to the AAA(+) domain of the PspF transcription activator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM10177.1	1.10e-145	1	587	1	591
VCV20591.1	4.40e-145	1	587	1	591
CCO05014.1	1.24e-144	1	587	1	591
CBL08623.1	7.01e-144	1	587	1	591
CBL14462.1	1.98e-143	1	587	1	591

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
231	253
257	279