CAZyme Information: MGYG000004534_00307

Basic Information

• Species: CAG-245 sp000434195
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-245; CAG-245 sp000434195
• CAZyme ID: MGYG000004534_00307
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	MGYG000004534_3|CGC2	90565.88	8.4563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004534	1382273	MAG	Israel	Asia

• Gene Location: Start: 75714; End: 78080 Strand: +

Full Sequence      

MDIKNMTLEEKASLCVGEDYWNSKEIKKYNIPKITMSDGPNGLRVQKDKQDNLGINESEK
ATCFPTLATLGNSWNRKIAYLLGKALAEEAKKEKINIVLGPAINIKRSPLCGRNFEYISE
DPFLTGILGSEYVKGMQSQNVGACVKHFAVNNQENRRRTIDAIIDERTLREIYLKAFQMI
IKKSKPWAVMSAYNKVNGEYCTENKHLLKEILRKEWKYNGIVISDWGAENNRVEGIKATN
DLEMPGGRGNGKEEIIKAVKANIISEKELDKIVERIIQTAQKTYDKTQEYSYNQKKHHEI
ALKIAEESVVLLKNENNILPIQKTKIAVIGDMAKEPRYQGAGSSTINPYNVENALESLRK
NNIEFEYAQGYERVESGNDEQLLKEAVNVAKRHDKVLIFVGLTENYESEGVDRETLQIPT
NQINLIEEISKVNQNIIIILSNGAPIEMRWQDKAKAIITGYLGGEAGASAMINCVIGKVN
PSGKLAETYPIKLEDTPCYNNYPGTELTVEYKETIYVGYRYYNTAKKKVLFPFGYGLSYT
QFKYSDLKIEQENYKVKILFKIKNIGKVKGKEIAQIYVSQSNPKIYKPLRELKEFKKVEL
KPGEEKIIKIELAKDSFEYYNTESRKWAIEEGTYEIQVGKSSEDIVLKDRITIKSQDADI
KAKYSDKYYNAEIQEITDKEFEEVLGRKIPERHLKIDEITEENTLEQIKETDIGKVIYNS
EMEKMNRLLKEQNVNKATKVMMDLQKPLKKFYEKHNSKITKEMVDELLDIVKNNKEYANC
KFLEIYLK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	24	245	1.7e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.85e-84	62	645	118	757	beta-glucosidase BglX.
COG1472	BglX	2.74e-72	30	366	59	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.09e-58	309	539	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	5.11e-56	61	545	111	639	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.29e-34	61	277	85	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEN03854.1	3.40e-238	3	774	9	795
ACN82588.1	4.55e-237	3	769	14	787
ANN62779.1	1.29e-236	3	769	14	787
QTM09637.1	1.83e-236	3	769	14	787
QTM12264.1	1.83e-236	3	769	14	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.55e-229	3	655	9	670	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.00e-166	3	662	9	669	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.73e-138	3	653	8	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.80e-137	3	653	8	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	4.83e-120	3	646	10	829	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.49e-228	3	655	9	670	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.64e-164	3	645	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.02e-163	3	645	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.16e-129	3	645	50	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	1.79e-120	3	656	15	841	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999626	0.000383	0.000010	0.000002	0.000001	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004534_00307.