CAZyme Information: MGYG000004535_00958

Basic Information

• Species: UBA10677 sp900767465
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp900767465
• CAZyme ID: MGYG000004535_00958
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	MGYG000004535_19|CGC1	50033.74	8.4863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004535	1710756	MAG	Israel	Asia

• Gene Location: Start: 10607; End: 11923 Strand: +

Full Sequence      

MFHTAASRPRGKALAVDWIYNVILIDLQGRSSSARSGCDVISDGVRVGHERREKIPAEIA
FRPCVPTRLFFTRAYRAAYIYRMKICVYAICKNESAFAERWVKSMSEADEITVLDTGSND
KSAEKLAALGARVRTKIVDPWRFDVARNLSLADVSEDADVCVCTDLDEVFEPGWRKKIET
VWRNGVTRGRYRYVWSHDGEAAGVEFLADKIHARRGYEWVNPVHEVLKPTGKEVWAAIDG
LTLHHYPNPKKSRAAYLPLLELAVKEDPSNDRNSHYLGREYYFRGAYDKAIAELERHLSL
PTAVWREERSASMRYIAASYRSLGKFDNAEKWYLRACLESPESREPSFDYARMLYSLGNY
AGAVFWLNKTLSVTVRSLSYISSPEAWGAEPYDLLALSLFALGSYDEAAKYGRRALELSP
SDERLKSNLYFYEEKTKK

Enzyme Prediction     

No EC number prediction in MGYG000004535_00958.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00006	TPR	3.15e-09	275	372	5	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
cd02511	Beta4Glucosyltransferase	4.89e-09	84	250	1	168	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	4.51e-08	313	417	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0457	TPR	2.20e-06	251	438	109	285	Tetratricopeptide (TPR) repeat [General function prediction only].
TIGR02917	PEP_TPR_lipo	4.68e-06	260	423	79	227	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42689.1	3.14e-127	83	431	1	353
QQR04409.1	3.14e-127	83	431	1	353
QIA29496.1	6.29e-127	83	431	1	353
QNK42027.1	5.26e-122	82	437	3	361
QOX65321.1	6.73e-121	84	435	5	359

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54435	9.74e-06	82	181	4	100	Lipopolysaccharide core biosynthesis glycosyltransferase KdtX OS=Serratia marcescens OX=615 GN=kdtX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999376	0.000584	0.000045	0.000003	0.000001	0.000011

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004535_00958.