CAZyme Information: MGYG000004536_00963

Basic Information

• Species: Alistipes sp900542505
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900542505
• CAZyme ID: MGYG000004536_00963
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		43653.23	9.9518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004536	2335647	MAG	Israel	Asia

• Gene Location: Start: 100245; End: 101393 Strand: +

Full Sequence      

MKYYLIAGEPSGDLHGANLIEGLRKADPEAQFRFWGGDRMARAGGERNLAKHYRETSFFG
IVQVLRNLGTIRRQMRECRQDVAAFAPDALILIDYPGFNMKMARWAHEQGIRTFYYIAPK
VWAWREHRVKSIRRYVDRLFIIFPFERQYFASKGITPIFEGNPLVDAIDRRLPELPTPEE
FRRRNGLDSRPIVALLAGSRAGEIRDNLPLMARLAERFPERQFVVAGVSWLDRSLYERYM
AGSSIRYVCDQTYETLAAAEAAVVTSGTATLETALLGIPEVVVYRTLWFQVKLRPYVLKV
PWVSLVNLNLGREAVRELIQSDLDITAAERELRAILEGGAGRGRMLDDFDQLRRIIGGPG
ASDRFARRMVGELRRDPAATDR

Enzyme Prediction     

No EC number prediction in MGYG000004536_00963.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	3.4e-105	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.28e-104	1	367	2	369	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.75e-97	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.77e-67	4	320	2	323	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.36e-64	5	366	10	379	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.91e-46	1	325	2	306	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77950.1	5.64e-229	1	373	1	373
BBL11605.1	8.90e-226	1	374	1	374
BBL08813.1	8.90e-226	1	374	1	374
BBL00808.1	1.26e-225	1	374	1	374
BBL06737.1	2.83e-222	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.14e-41	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.14e-41	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	9.99e-64	2	366	8	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	1.93e-63	2	366	6	371	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.06e-62	5	366	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q2IL69	3.52e-60	5	374	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q39T49	7.14e-60	2	366	8	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004536_00963.