CAZyme Information: MGYG000004536_01428

Basic Information

• Species: Alistipes sp900542505
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900542505
• CAZyme ID: MGYG000004536_01428
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		37760.02	10.3696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004536	2335647	MAG	Israel	Asia

• Gene Location: Start: 7354; End: 8385 Strand: +

Full Sequence      

MARSKRPGHLLVLRTSAMGDVAMLPHALRAFQSACPDVKVTVATRPLFRPFFEGLDVDFL
DVDTKGAEHSLRGMWRLAARARSMGVDAVADVHGVLRSKAFRLSMWLHGVRVAHIRKGRL
AKWMRMKSGGESCAAPLRHTVLRYCDVIRRLGFDFPDPTPAVRLPRPNPMGEKRGVWLGF
APFSAQRGKTYPEDLAREAVALLAARCERLFIHSGGGAEAEFAAEMERTHPNVTALWGRV
RLAEERDLIANLDCVVSMDSLVMHLAALVATPVVSVWGATHPSLGFVGYGTSPEGVLQAN
LSCRPCSVFGKKPCKWGDYRCLRAITPEMIARRVDALLGRSGE

Enzyme Prediction     

No EC number prediction in MGYG000004536_01428.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	74	317	2e-34	0.9688888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.08e-36	9	336	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	8.41e-15	74	319	1	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.13e-06	229	280	240	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77232.1	6.77e-169	5	340	7	341
BBL09491.1	2.40e-162	18	339	1	321
BBL01632.1	3.41e-162	18	340	1	322
BBL13855.1	1.21e-157	7	338	2	331
BBL04346.1	1.72e-157	7	338	2	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	2.98e-06	10	290	3	291	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	2.98e-06	10	290	3	291	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	3.05e-06	10	290	3	291	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004536_01428.