CAZyme Information: MGYG000004537_01198

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; UBA3637
• CAZyme ID: MGYG000004537_01198
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000004537_58|CGC1	34891.19	6.2284

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004537	1450923	MAG	Israel	Asia

• Gene Location: Start: 3545; End: 4501 Strand: -

Full Sequence      

MEKPIASVIFGLSGLSLTDEERAFFERVNPLGFILFDRNVKDPDQLQALTTDLRATVGRS
DAPILVDQEGGRVQRLWPPYWEGLPFARTYGDWYVEKTPAEALKAVTKHAEKLAQMLLKV
GINANCWPCLDVASPESHSVLGKRLFSDQPDVVSLLGNQAVETMLDKGLMPVIKHIPGYG
KATCDPHADLPVVSADLKALETDFTPFRRAHKHVWGMTAHVLYTALDDQKPATLSRKVLD
FVRHDIGFQGFLVCDDISMGALKGRPDVLASDCLKAGCDAVLHCNGCLDEMQAVAAVLPP
LSDKSLARYVKAESLKNG

Enzyme Prediction     

No EC number prediction in MGYG000004537_01198.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	64	282	8.8e-32	0.9351851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.76e-69	11	308	11	307	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	9.57e-48	8	308	4	304	beta-hexosaminidase; Provisional
pfam00933	Glyco_hydro_3	1.08e-39	32	295	34	296	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMW35210.1	7.53e-101	7	314	9	316
BBK30884.1	1.38e-96	9	316	1	309
BBK38341.1	3.51e-95	7	316	13	323
BBK43771.1	3.52e-94	7	316	31	341
AVM77618.1	9.40e-94	6	316	9	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VI6_A	8.38e-36	9	316	5	304	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
3TEV_A	5.35e-31	19	316	32	325	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
5G1M_A	1.05e-30	7	297	24	308	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
5G5U_A	2.79e-29	7	297	24	308	Crystalstructure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G5U_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_A Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_B Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5LY7_A Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5LY7_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
6K5J_A	3.16e-29	8	298	21	313	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5P081	7.04e-39	3	285	12	296	Beta-hexosaminidase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=nagZ PE=3 SV=1
Q0A911	8.69e-38	5	308	3	309	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
Q2KXM7	2.57e-36	4	304	11	315	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
Q0AF74	1.31e-35	5	285	3	284	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q7NWB7	1.15e-34	1	311	1	311	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004537_01198.