CAZyme Information: MGYG000004538_00010

Basic Information

• Species: CAG-313 sp900760745
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; CAG-313; CAG-313 sp900760745
• CAZyme ID: MGYG000004538_00010
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	MGYG000004538_1|CGC1	72433.75	6.1136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004538	1759821	MAG	Israel	Asia

• Gene Location: Start: 8731; End: 10578 Strand: +

Full Sequence      

MQEKGIYYFHQGTNYHAYDLLGAHYQKGATIFRVWAPNAKIVSVVGEFNNWDTTQNVMHK
ISNQGIFEVTIEGVKEYQCYQYAILTTDNQLLFKSDPYGYHAELRPEKASKVYDLEGFTF
SDQEWMKERKNRQALNQPMNIYEVHLGSWRRYQDGSFFDYEKLAYELSKYVKKMGYTHIE
IMPISEYPYDPSWGYQVTGYYAITSRYGTPKDFMRFVDILHHENIGVILDWVPGHFTKDS
HGLIEFDGKPLYEPSDETKKEHEGWGTRCFDYGRNEVQCFLVSNAVFLFEKFHIDGLRVD
AVASMLYLDYGRTDGNWHKNHLGTNINLEAVAFLQKLNATIHQFFPGVLMIAEESTAYPK
VTYATNENGLGFDYKWNMGWMNDSLSYIKTNPLFRQYDHHKLTFQLTYIFSERYILPLSH
DEVVHLKGSLIHKMPGEYEEKFASLKTYFTYMMTHPGKKLLFMGGEIGQFREWSEERELD
WSVLNYQQHQGLQAYVQDLNHLYLESKPLYENELNWDGFRWLMVNDANHNVLAYERKDYE
NHSLYIILNFAYCNWENYLLPLDNGLYEVVLSSSDKQYGGNIQLKSNQFIVINQKLKINL
PSNTGIILRKVEEYV

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	170	469	2.3e-148	0.9933554817275747
CBM48	21	100	2.1e-16	0.8552631578947368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	6	609	12	626	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	3	581	605	1186	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	1	580	6	590	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14706	PRK14706	0.0	20	611	26	622	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	6	609	105	722	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI60003.1	2.23e-237	6	581	13	593
QCT05966.1	5.15e-235	9	580	15	591
QOX62812.1	1.35e-234	6	599	11	608
QGS08178.1	1.17e-232	1	610	1	615
CBL01646.1	2.19e-232	6	581	17	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	3.67e-193	1	581	129	737	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	5.19e-193	1	581	129	737	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR2_A	7.34e-193	1	581	129	737	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQU_A	1.04e-192	1	581	129	737	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQZ_A	1.04e-192	1	581	129	737	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	1.70e-206	7	586	12	596	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q24VW3	1.04e-205	1	580	12	592	1,4-alpha-glucan branching enzyme GlgB OS=Desulfitobacterium hafniense (strain Y51) OX=138119 GN=glgB PE=3 SV=1
B3PGN4	3.99e-200	3	609	117	735	1,4-alpha-glucan branching enzyme GlgB OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=glgB PE=3 SV=1
Q8CZE8	1.94e-199	4	601	7	618	1,4-alpha-glucan branching enzyme GlgB OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=glgB PE=3 SV=1
P30538	5.89e-199	6	580	11	581	1,4-alpha-glucan branching enzyme GlgB OS=Geobacillus stearothermophilus OX=1422 GN=glgB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004538_00010.