CAZyme Information: MGYG000004541_01678

Basic Information

• Species: Ureibacillus endophyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Ureibacillus; Ureibacillus endophyticus
• CAZyme ID: MGYG000004541_01678
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	MGYG000004541_22|CGC1	26912.89	4.591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004541	3519256	MAG	France	Europe

• Gene Location: Start: 35127; End: 35843 Strand: +

Full Sequence      

MAKKKKKKPLISPGVKLFLILLLIPASITIYFFAFLAWQELKSLPFISDLVQSEMDIVQE
NLDLKIPEEYIPIYMAAEEKYGVPWTLLAAHHRIETRFSTMKTLVSPVGAEGHMQFMPCT
FVGWGHPTCSGLGEGEIPEEEKTNPKIIKKYGGYGVDANQDGIADPYDIEDAIFSAANYL
AKAGVSKGELKKAIYNYNHSEEYVDDILYYYHLYEDVSDELEQLILATDESKTIDEVK

Enzyme Prediction     

No EC number prediction in MGYG000004541_01678.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	74	214	2.5e-18	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	3.19e-33	81	209	1	104	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	5.99e-11	63	189	105	245	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam13406	SLT_2	3.58e-09	69	189	72	205	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
pfam01464	SLT	4.64e-07	76	198	3	93	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	4.77e-06	77	182	4	70	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR34480.1	5.46e-120	3	225	7	229
QDP99068.1	7.11e-115	1	226	1	227
QPQ35348.1	2.26e-114	1	226	1	227
AWE07400.1	5.74e-112	5	226	4	226
ATP40536.1	1.59e-111	1	226	1	227

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.875946	0.003109	0.002050	0.000030	0.000013	0.118877

TMHMM  Annotations     

start	end
17	39