CAZyme Information: MGYG000004544_00292

Basic Information

• Species: Alistipes sp900290115
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900290115
• CAZyme ID: MGYG000004544_00292
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280	MGYG000004544_2|CGC2	32097.29	5.3908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004544	2598681	MAG	France	Europe

• Gene Location: Start: 111047; End: 111889 Strand: +

Full Sequence      

MLMFAAMLLFAAPLTAQSRLETFTLRSELLGAEKSCTIYLPDGFDADPTRRYPVLYLLHG
ASDTHTAWSEPTKGQMQQILDEAIAEGRSVKMVVVMPDASGEDENHTGRHMGYYNVPDWP
YERFFFEELMPAVERRYRIRSEKQSRAIAGLSMGGGGTATYAQHHPELFSSACPLSAAME
PRPIPGDPNDYERSRIENSPLRFLQQMTDEQAAALRTVRWRVDCGDDDFLWQGNIRFYEQ
MRLHNIPLEYRMRDGGHTWRYWRTALPEVLTFVSIGFGQE

Enzyme Prediction     

No EC number prediction in MGYG000004544_00292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	27	273	1.7e-57	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.85e-35	27	280	28	315	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	4.31e-29	27	270	1	243	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	1.11e-28	15	272	64	294	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PRK10439	PRK10439	2.52e-07	11	266	171	399	enterobactin/ferric enterobactin esterase; Provisional
COG4947	COG4947	6.56e-06	121	267	90	224	Esterase/lipase superfamily enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD44687.1	7.11e-34	33	270	151	380
SCD19884.1	1.53e-33	37	270	160	385
AXB79012.1	1.02e-32	13	263	163	396
AEE54274.1	1.07e-32	34	259	146	354
AYQ31931.1	8.65e-32	30	268	159	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	2.72e-79	12	280	4	275	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	1.37e-34	26	268	138	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
4RGY_A	2.07e-22	27	275	11	263	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7B5V_A	3.38e-21	27	155	146	275	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
1JJF_A	3.73e-21	27	266	39	250	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	2.22e-19	27	266	58	269	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	9.25e-19	38	270	449	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	7.84e-18	20	169	500	646	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	3.93e-14	16	265	139	379	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P9WM38	1.99e-10	19	172	173	314	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000463	0.998808	0.000172	0.000197	0.000166	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004544_00292.