CAZyme Information: MGYG000004545_00096

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; UBA4855
• CAZyme ID: MGYG000004545_00096
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000004545_1|CGC3	59546.03	9.1414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004545	1487294	MAG	France	Europe

• Gene Location: Start: 114431; End: 115945 Strand: +

Full Sequence      

MRKKECGVLLHISSLPGKYGIGTLGENAYKFIDFLSECGFSYWEILPIEDVGKGNSPYDI
PSAYSLNYLFIDFEELIKDGLLTSRDFTGIDFGQNPRKIDYIKLKESKTQILKQAFKRFD
KTNPDFIEFKNNPFRYQYALYETIKSKNQDKSWFDFRLEDRYFGSEIREEYQKKYSSEID
YYLFLSFLFVKQWNKLHNYAKKKGIDIVGEVPHFLSYDSDTMYMTPELFIIDKRNMPTYV
VGFPPDNFRKEGQKRGYPLYDWDYMKMSNYKWRRYRLNVAKGFYDRIKLNHFRGFYQIYA
VNFRSKNGRKGIYLNGPGLEFVNDIKKEYPLIANNLGTYSKDVSNFVEKTGLPGLSVVCG
NFFATKFYSDSFLPSNINENTYLYLGNHDNLPIKGLLDVLTDEERKLGEKRIIEEAKKMG
VELKEGMSLFEKTRFLFELAFASKADHVTLTMQDILFQGKESRMNEPGTVNEENWTYRFL
WHDLSKEIEQSLKNLIIKYQRAKK

Enzyme Prediction     

No EC number prediction in MGYG000004545_00096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	10	495	9.4e-103	0.9858299595141701

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	1.93e-145	1	502	2	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	4.90e-113	10	479	1	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	2.37e-99	2	501	26	525	disproportionating enzyme
COG1640	MalQ	1.28e-91	1	504	11	517	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	6.98e-72	3	501	13	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ97210.1	1.55e-105	4	492	10	495
ATD55697.1	2.80e-105	3	501	2	490
ATD56626.1	2.80e-105	3	501	2	490
QBJ75996.1	2.80e-105	3	501	2	490
SLK21116.1	2.80e-105	3	501	2	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M6T_A	3.80e-87	2	504	3	499	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
1TZ7_A	1.54e-85	7	478	25	482	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
5CPQ_A	1.92e-74	3	478	69	537	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1X1N_A	3.63e-70	3	478	25	497	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	1.17e-69	3	478	77	549	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	7.13e-89	10	502	1	486	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
O66937	1.25e-85	7	478	5	462	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P0A3Q0	3.58e-83	1	501	1	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	3.58e-83	1	501	1	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
Q9LV91	1.39e-73	3	478	81	549	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004545_00096.