CAZyme Information: MGYG000004547_00057

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274
• CAZyme ID: MGYG000004547_00057
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000004547_2|CGC1	36127.71	4.6281

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004547	2604006	MAG	France	Europe

• Gene Location: Start: 6659; End: 7615 Strand: -

Full Sequence      

MKLMKKIVVDLNGSGDFLTVADAIKSIQNGEETQVFIKNGVYKEKLIIDKPNVSFVGENR
NDTILTFDDGAWGIDPETNEPMGTFKTASVHVLKTGEGFSAENLTFENSAGMGDEVGQAV
ALYLDCDKAVIKNCRLIARQDTLLTAPMHEDIAREPKRLNRQYFENCYIEGDVDFIFGGA
TAVFKNCEICGLDRKKDVNGYYTAACTAKDMEFGYVFFDCKFTTDCADDETYYLGRPWRE
FAKTVFINCEMGKHINRESFSKWNKFEERSKTCYYAQYNSTGEGFNKDCVADWTHILSDD
EAKIYTIENIFKDWCPTK

Enzyme Prediction     

No EC number prediction in MGYG000004547_00057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	7	312	2.8e-92	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.98e-77	7	314	83	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.13e-65	7	309	2	293	Pectinesterase.
PLN02665	PLN02665	2.35e-55	5	303	68	346	pectinesterase family protein
PLN02773	PLN02773	2.54e-53	9	302	9	287	pectinesterase
PLN02432	PLN02432	3.62e-53	7	314	13	285	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58031.1	3.68e-99	7	310	2	312
BAV13196.1	4.47e-99	8	316	2	320
ADL51177.1	4.47e-99	8	316	2	320
AQR96711.1	5.21e-99	7	310	2	312
AGC69600.1	7.20e-95	8	310	2	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	3.70e-35	7	306	9	297	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.40e-33	8	312	6	299	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	9.31e-32	8	314	34	361	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.22e-30	17	317	18	340	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	7.66e-26	11	284	13	265	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FM79	1.28e-43	7	303	82	364	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8L7Q7	1.68e-42	3	317	285	600	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9LVQ0	4.83e-42	1	302	1	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9LXD9	1.68e-40	3	312	237	542	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q8GXA1	1.04e-39	8	316	259	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004547_00057.