CAZyme Information: MGYG000004548_00133

Basic Information

• Species: AM51-8 sp900546435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp900546435
• CAZyme ID: MGYG000004548_00133
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1061	MGYG000004548_1|CGC2	122787.81	6.0264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004548	2412445	MAG	France	Europe

• Gene Location: Start: 142989; End: 146174 Strand: +

Full Sequence      

MRQLLEKIRHSQFYKEHLKQLPVTQALLKVRDKGKNVVGYLQEKADPSRKRENLLVLLQK
HFYSWNSFDAECGRQDHMESPVDVIVPIYNGYEYLVKLLPELLRTKMQVTYILIDDNSTD
GRILPLLQQFAQQHHSVILLQNEQNLGFVGTVNRGLEASTHHVALVNTDTELPEEWLERL
MSPILEDNTVASTTPFTNSGTIFSFPEFAQNNAIYEGMCEEDVDAVFSHVRPMYQNVPTG
MGFCMGMNRKALDEIGGLDQKAFGRGFGEENDWCLRAKAKGYHDVQVENLFVYHKHGGSF
ASAEKEKLIADHMNILYQRYPMYEYDVTKYVKEDPQKQLRLLIQLLLNCHSKKTILYVIN
DWGGGSERYFSMQREKQIQKGKGVFSLCYSKQKGYYELDYADQHLEQKYYVERVIDLAAL
SKWFSLEEIIINQLTLYPQLEQTLQDIIEVKKAHQAKLTMLFHDYYAICPSYNLTQKAGS
FCKDEIGTKCQKCYEEWMFAKQMGCDSVNQWRMWWKALLEQCDEVRCFSQDTLKRVKNVY
GCDLAYTLVPHQVDYLCQIEKRTKMTNALNIGILGGLSAHKGGRVVQQMLCEIEKQQLPV
RIVLIGYPDGIKLQQSEKLIATGAYEATELPALVYQYDVDIVFIPSIWPETFSYTAEEAM
QMHLPLVSFDLGAPAERIACYDRGMTIPLESNIKEWLPQVYRWGVEQTASHKVGSKEVVY
VSEYKSFSSRYRLLHMAEEMLVQGVAARVYEEVYPKQIDWNQVDALCVYRCRYRGRIKQM
MQEAKQYHIPIIYDIDDAIFDYEHMDYVPDIDKNVYGDFKTYSAELLECMRQADRITVST
DCLKKAVERCLPNKPVFVNRNVASMQMQGISRSIYEARKNRKIDENVILGYFSGSNTHNG
DFALVAATILEIMKKYPQVYLKIGGCLELPREYDMMSDRIVRKDMVPWQRLPEEIAKTDI
NLMPLEDTFFHKCKSENKWMEAAFVGVPTIATYNEEIAGATSDGKDIVLCHNLEEWHDEL
EKLICDANYRNKIADCAHDTVLQQKTTQSVRGELVDFVLGI

Enzyme Prediction     

No EC number prediction in MGYG000004548_00133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	83	255	4.8e-20	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	8.74e-28	84	332	7	256	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	9.06e-27	84	296	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd03794	GT4_WbuB-like	5.20e-20	784	1055	119	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
pfam00535	Glycos_transf_2	1.28e-18	83	252	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	8.63e-16	84	199	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM10216.1	8.79e-236	82	1060	885	1860
QCU01345.1	2.90e-224	79	1059	897	1872
BBK78212.1	4.38e-167	82	692	167	775
QMW89726.1	4.38e-167	82	692	167	775
BAS49353.1	1.94e-126	52	691	761	1404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	9.73e-06	82	218	7	151	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004548_00133.