CAZyme Information: MGYG000004548_01169

Basic Information

• Species: AM51-8 sp900546435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp900546435
• CAZyme ID: MGYG000004548_01169
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	MGYG000004548_16|CGC1	49074.52	4.9868

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004548	2412445	MAG	France	Europe

• Gene Location: Start: 18816; End: 20120 Strand: -

Full Sequence      

MGKFPQGFMVGASTAAHQVEGNNVHSDYWLQENVEHSQFVEPSGKAVDHYHRYEEDIRLM
AEAGLNAYRFSIEWARIEPKQGEFDENEIEHYRKVIACCKENGVEPVVTLHHFTSPAWVI
SRGGWENEEVVDWFANYVQYVVKHLGSELRYICTINEANMRLQLAAIMKKYMSQMAGEQQ
EEKNAPKEGDVQVGLNLDQGMNTMMLGMMECAKAFGLQDPRGIHTFVSMCTPEGDILVMK
AHQAAKKVIKELYPDIKVGLTLSLHDMQPATGGEDAAHKEWEEEFSHYLPYIAEDDFLGV
QSYTRQCFDGKGNKYTPEGVELTQMGYEFYPQAIANVVRAAAKEFKGDLVVTENGVATAD
DSRRQEYIKEATAGLQACITDGIPLKGYLHWSLMDNFEWQKGFSMQFGLIAVDRSNMKRT
PKESLSLLGSMTTK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	431	8.6e-120	0.9766899766899767

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	6.78e-92	1	424	1	442	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
TIGR03356	BGL	3.36e-90	5	424	1	422	beta-galactosidase.
pfam00232	Glyco_hydro_1	1.61e-76	2	424	3	440	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.17e-56	1	424	2	455	6-phospho-beta-galactosidase; Provisional
PLN02849	PLN02849	9.14e-37	4	424	30	472	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE67958.1	3.58e-200	4	429	3	423
AXB29242.1	7.46e-200	1	432	1	431
CBK75894.1	3.63e-198	4	431	2	433
AHF24559.1	1.83e-196	4	431	3	436
CBL02685.1	3.84e-195	1	429	1	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	5.02e-114	4	430	7	407	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	4.30e-92	7	431	35	427	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	3.09e-66	3	424	10	437	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	9.08e-62	3	431	4	402	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
7E5J_A	4.67e-53	4	424	6	433	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10482	1.70e-50	4	424	5	443	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
Q08638	1.96e-50	3	424	5	431	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
Q03506	1.13e-49	4	424	6	435	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
B9K7M5	1.93e-49	1	424	1	429	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P0C946	1.33e-48	1	419	1	424	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004548_01169.