CAZyme Information: MGYG000004551_00999

Basic Information

• Species: Phil1 sp004558525
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; Phil1; Phil1 sp004558525
• CAZyme ID: MGYG000004551_00999
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000004551_6|CGC2	26433.82	10.1431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004551	1887614	MAG	France	Europe

• Gene Location: Start: 85408; End: 86121 Strand: +

Full Sequence      

MSTTGAPAMAKPAKKKGGGKAKAKKQVSPAGKKLKRSAKSKSSIKDAKLKKLALILCIFA
AAAMLVIAGLYANRMLEMRTYKLLYPEEILSGAKEYSLDPYLVAAVIQTESSNRANVVSN
KGAVGLMQIMPKTGEWISEKIGMSDYSEDMLREPYVNIRFGCWYLRYLSDKYGGIERSIL
SAYNAGPGNVDKWLSDPRYGDGKRLLDIPYKETREYVEKVSSTKEKYRELYEKELGK

Enzyme Prediction     

No EC number prediction in MGYG000004551_00999.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	98	226	3.4e-30	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.04e-74	83	226	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.23e-49	81	230	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.55e-39	100	222	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.93e-31	40	233	97	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.69e-26	89	195	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39946.1	7.35e-51	55	232	19	195
QWT54455.1	2.18e-50	54	231	28	206
AWZ48130.1	7.67e-49	55	232	5	184
ADV80073.1	4.38e-47	79	232	29	183
VTQ87399.1	5.09e-47	65	231	15	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.29e-18	93	222	457	587	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.31e-18	93	222	486	616	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	3.21e-18	93	222	457	587	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	3.21e-18	93	222	458	588	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	6.52e-17	85	231	416	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.53e-20	89	222	64	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	9.34e-20	85	220	1422	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	9.34e-20	85	220	1422	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P39434	8.62e-14	105	228	500	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	5.26e-13	105	228	500	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999854	0.000157	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
52	71