CAZyme Information: MGYG000004552_00452

Basic Information

• Species: Frisingicoccus sp900757195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Frisingicoccus; Frisingicoccus sp900757195
• CAZyme ID: MGYG000004552_00452
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		29214.58	4.5377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004552	2535946	MAG	France	Europe

• Gene Location: Start: 148282; End: 149064 Strand: +

Full Sequence      

MNHFAKVVKTVLGIFLGTMILCMGVLTLKGYKEYRDALAEKPLEQSLEEVFQKEDFISLS
EISPIYKDALIAVEDHRFYNHPGVDVIAIGRAVVNDLRAGALVEGGSTITQQLAKNIYFS
QEKSFSRKIAEVFMAMKIESEYSKEEILDLYVNSIYYGDGYYTLKSACEGYFGKEPEAMN
DYECTLLVGVPNAPSVYAPTASMELAEKRQNQVLEAMLRQGMIDEEDKQMILAQEAAGDS
GFFIVFRFSVLFPSYLCVRA

Enzyme Prediction     

No EC number prediction in MGYG000004552_00452.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	52	217	2.7e-61	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	6.22e-80	52	218	11	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	8.16e-75	56	227	4	175	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.68e-72	52	234	74	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.46e-63	6	227	3	240	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	1.62e-49	11	234	18	231	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP41835.1	1.23e-82	20	226	18	225
ASN93505.1	1.23e-82	20	226	18	225
QJU22158.1	9.97e-82	20	226	18	225
ANU46909.1	4.03e-81	20	226	18	225
QQQ98385.1	4.03e-81	20	226	18	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	6.41e-43	52	226	18	192	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.55e-42	52	226	18	192	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	4.65e-37	57	229	42	214	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	1.13e-35	47	234	50	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.20e-35	47	234	14	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	1.54e-42	52	235	66	249	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P38050	4.74e-41	57	234	70	245	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O86088	3.14e-40	52	235	66	249	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1
O87579	4.28e-40	52	235	66	249	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	1.09e-39	52	235	66	249	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991224	0.002355	0.004489	0.000016	0.000010	0.001923

TMHMM  Annotations     

start	end
7	28