CAZyme Information: MGYG000004555_00119

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA7067
• CAZyme ID: MGYG000004555_00119
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000004555_4|CGC1	41528.99	8.4046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004555	1866920	MAG	France	Europe

• Gene Location: Start: 18463; End: 19590 Strand: -

Full Sequence      

MRVLIFTASTGGGHKKASAALENYIKSRDSEAVIKTVDALKAVGKAFDKLISGGYVFLAK
HAPRVYGKMYRQSDKDTKLNSLVDNVTGVASRKIFPLVDDFKPDAIVTTHPFAAEMVSAI
KGKHGLSVPLISIVTDFAPHKTYIQPYVDYFVVSSNEMKYQLENLGIKGSSIRTLGIPVD
PVFYKKQDKNALLDEMELEHDVPTILMMAGSFGVSDVFDIYEGILSIQQKFQLIIITGNN
KKLYNEFEQTLEKHGDGGKRTRLHFFVNDVYRYMHASDLLITKPGGLTVTEALASCLPMA
IFKAYPGQEADNEDFLIRNNMAVQLPKGKKCAPVIERLISDSEKLDSMKASCGEFFKGKA
VETIYNLISEACGKN

Enzyme Prediction     

No EC number prediction in MGYG000004555_00119.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	204	353	5.6e-26	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	2.31e-100	3	370	1	361	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	1.98e-50	2	375	6	372	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	7.06e-48	2	368	1	351	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13608	PRK13608	1.07e-38	102	351	104	348	diacylglycerol glucosyltransferase; Provisional
PLN02605	PLN02605	1.54e-31	3	364	1	371	monogalactosyldiacylglycerol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1254006.1	6.63e-119	1	374	1	378
QAT48338.1	7.91e-116	1	370	1	367
QPJ85060.1	2.11e-115	1	368	1	365
QEY34929.1	3.89e-114	1	375	1	372
CAB1242044.1	9.42e-112	1	370	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	7.68e-23	2	374	7	386	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CPR3	2.98e-37	2	364	7	361	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=ugtP PE=3 SV=1
Q6GI67	5.75e-37	2	348	7	345	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=ugtP PE=3 SV=1
Q5HQE7	1.54e-36	2	364	7	361	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=ugtP PE=3 SV=1
A8FED1	1.85e-36	2	370	6	367	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
Q2FI60	2.98e-36	2	348	7	345	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004555_00119.