CAZyme Information: MGYG000004557_00398

Basic Information

• Species: UBA5446 sp900545405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA5446; UBA5446 sp900545405
• CAZyme ID: MGYG000004557_00398
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
991	MGYG000004557_5|CGC1	112974.78	4.9279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004557	2548917	MAG	France	Europe

• Gene Location: Start: 1007; End: 3982 Strand: +

Full Sequence      

MLIPNYFEDPSILHIGTMPVCSYFVPAGNEHAARLRREYSEYFHSLNGKWNFKFIENVRS
LSTPYWEEGSNYVWDCQIDVPSSWQTKGFDRNQYTNIRYPFPYDPPYVPFVNPCGAYKRD
FQYQKRAGKRAILACEGIDSCYYLWINGRFVGYSQISYSTSRFDITDHIKNGDNTISILV
LKWCDGSYFEDQDKFRMSGIFRDIYIIERDESCIEDIKVTTDIMPHGAEIAVGLSLSGGN
PEVRYRLFSPGGNVISSGIYEDGLSIKVESPKLWTAETPELYTLLLHCGTEYIAQNVGIR
KISIDEDLRICLNGSPIIFNGMNRHDSDPGTGAYASFEQIERDLHMMKSFNINAVRTSHY
PPCPALLDLCDRLGFYVIDEACIETHGVTALYGEDADFGLLADDPAYGESILDRVRHMVL
RDMNHPCVLIWSMGNEAGYGRNFVAALEWTKSTDPTRLTHYESSIHPYKESEFSTDCLDV
YSRMYPSIAEIEEYFSSHPKKPLILCEYCHSMGNGPGDLEDYRQCMRRYPGFCGGFIWEW
CDHAVLEHDENGHEIYLYGGDFGDIPNDGNFCVDGMVFPNRRPHTSLHEYKQVIRPVRLI
DYDIAAHRFVFENTRDFLSPADDLRLRCYMLEDNVETELFSLKGQAIDIAPHQSRKFYFA
YSEPTSDFASLAFRWYNNREEDVGHDQVIIREPTFSPIALSGNGETWTVFENDLESVASS
GHLCAVWSKADGMLKSLTLGSNVVMKDVSLNIWRAPTDNDMYIRREWEAAGYDRVIYRAK
SFHSSVKDGVFQISSHVSAGAVSLQNIFEADLVWKLTVSGAIEVSVSAIRNTAMPYLPRF
GWRLFLPSEFSAADYIGFGPYESYIDKHQASLCGCYRMEIAEGTEPYIRPQESGSHWNCT
HLQACGESSRIEVRSDSRFSFNFSEYTQEELTQKRHWHEVVPSGSSVLCVDLLQSGVGSN
SCGPELDARYRADKEKIAGVFQFLLSGTNIK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	34	872	1.8e-190	0.9707446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	8	971	18	1019	beta-galactosidase.
PRK10340	ebgA	0.0	5	971	2	985	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.49e-132	38	872	7	805	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	7.92e-100	306	597	4	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	5.75e-60	719	985	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEY64450.1	3.45e-309	1	976	1	1004
ACL74542.1	1.66e-307	1	976	1	1005
QNU67165.1	1.00e-304	1	976	1	1032
QEI33157.1	1.42e-288	1	976	1	1008
QHB22488.1	1.42e-288	1	976	1	1008

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	1.56e-170	3	960	1	956	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	2.14e-170	4	960	1	955	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6CVM_A	5.94e-144	7	971	15	1007	Atomicresolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_B Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_C Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_D Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6X1Q_A 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_B 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_C 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_D 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12]
1JZ7_A	8.71e-144	7	971	16	1008	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]
3MUY_1	8.71e-144	7	971	16	1008	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	1.44e-261	1	988	1	1002	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	8.96e-224	1	977	1	985	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
Q56307	8.56e-170	3	960	1	956	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
A7MN76	3.86e-156	1	970	21	1025	Beta-galactosidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=lacZ PE=3 SV=1
A8GGN3	7.48e-156	1	970	12	1010	Beta-galactosidase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004557_00398.