CAZyme Information: MGYG000004559_01652

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000004559_01652
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000004559_87|CGC1	38625	9.4427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004559	2216405	MAG	France	Europe

• Gene Location: Start: 2148; End: 3152 Strand: -

Full Sequence      

MTGTLNFKLTQMLVAISTATLLMISATLTAAGQQQTREEYIEKYKNAAMQYMKTHGIPAS
ITLAQGCLESANGNSDLAVKANNHFGIKCHNDWKGPTYYKKGDDPGKSCYRKYRNAADSY
KDHSDFIRYGQRYAFLFDLEITDYKGWSHGLKKAGYATDPQYAQKLIKIIEDYQLYRFDR
EIYASAEKNHNLLPPSPNQLQQVMELDPAKNSLLYKYSRNRTIYVRNGVPYIIAGDLDTY
ESIAGEYNLFTKELLRFNDLKKPMDLTPGTVVYLQRKKARAQRHMEIHIAVEGDTYYDIA
QKYGVRMKKLFKYNDYREGDILHIGDEVFLRRHK

Enzyme Prediction     

No EC number prediction in MGYG000004559_01652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	46	175	1.7e-35	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	1.68e-38	34	179	157	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	3.63e-37	5	180	11	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	3.37e-27	45	175	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	6.09e-25	38	179	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK12709	flgJ	5.34e-18	28	171	164	317	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53917.1	3.97e-113	17	331	7	312
QKG80574.1	1.08e-87	22	334	12	311
QDO71591.1	4.76e-87	18	331	7	305
CBW22044.1	7.88e-87	5	331	1	299
ALB75916.1	7.88e-87	5	331	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	1.49e-12	25	237	49	272	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	4.53e-10	56	170	20	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.34e-10	56	170	21	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	1.54e-09	56	171	22	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.00e-09	56	171	22	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.58e-15	46	179	58	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q2G222	3.21e-12	25	237	309	532	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9KQ15	7.09e-12	33	186	157	327	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	2.13e-10	24	169	147	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P58231	7.61e-09	56	171	168	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001012	0.997978	0.000399	0.000228	0.000186	0.000174

TMHMM  Annotations     

start	end
13	32